(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGE

CP001396.YBGE        Location/Qualifiers
FT   CDS_pept        676292..676585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="BWG_0594"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0735"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62209"
FT                   /protein_id="ACR62209.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF"
     atgagtaaga ttatcgcgac tttgtatgcg gtaatggaca agcgccccct gcgggcgctt        60
     tccttcgtga tggcgcttct gttagcagga tgtatgtttt gggacccatc tcgttttgcc       120
     gcgaagacca gtgaactgga aatctggcat ggtttattgc tgatgtgggc cgtctgtgct       180
     ggtgtgattc acggcgtggg ctttcgtccg cagaaggttc tttggcaagg gattttttgc       240
     ccattgcttg ccgatattgt tctcattgtc gggctgattt tcttcttctt ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page