(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGT

CP001396.YBGT        Location/Qualifiers
FT   CDS_pept        676179..676292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgT"
FT                   /locus_tag="BWG_0593"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b4515"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62581"
FT                   /protein_id="ACR62581.1"
FT                   /translation="MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI"
     atgtggtatt tcgcatggat tctgggaacg cttcttgcct gttcgtttgg ggtaatcacc        60
     gcgctggcgc ttgaacacgt cgaatcaggc aaagccggtc aagaagacat ctga             114
//

If you have problems or comments...

PBIL Back to PBIL home page