(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBHM

CP001396.YBHM        Location/Qualifiers
FT   CDS_pept        722984..723697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhM"
FT                   /locus_tag="BWG_0640"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0787"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62210"
FT                   /protein_id="ACR62210.1"
FT                   /translation="MESYSQNSNKLDFQHEARILNGIWLITALGLVATAGLAWGAKYIE
FT                   ITATKYDSPPMYVAIGLLLLCMYGLSKDINKINAAIAGVIYLFLLSLVAIVVASLVPVY
FT                   AIIIVFSTAGAMFLISMLAGLLFNVDPGSHRFIIMMTLTGLALVIIVNAALMSERPIWI
FT                   ISCLMIVLWSGIISHGRNKLLELAGKCHSEELWSPVRCAFTGALTLYYYFIGFFGILAA
FT                   IAITLVWQRHTRFFH"
     atggaatcat actcgcaaaa cagcaataaa ttagattttc agcacgaggc caggatatta        60
     aacggtatat ggctcattac cgctttaggt ttggtggcaa ccgcaggact agcctgggga       120
     gctaagtata tcgaaattac ggcaaccaaa tatgattcac caccaatgta tgtcgccata       180
     gggttattat tactttgtat gtatggctta agtaaggata tcaacaagat aaatgccgcc       240
     atcgcgggcg taatatatct gtttttactc tctttggtgg cgattgtcgt tgcaagttta       300
     gttcctgtat atgccattat catcgtgttc agcactgcgg gcgcgatgtt tttaatcagt       360
     atgctggccg gtttattatt taatgttgat cctggttctc accgttttat cattatgatg       420
     acgttgacag ggttggccct ggtaatcatc gtgaatgcgg cattaatgag tgaacggccc       480
     atttggataa taagttgctt aatgattgtg ttatggtcag gcattatctc gcatggacga       540
     aataagctcc ttgaattggc ggggaaatgc catagtgaag agttgtggag tccggttcgt       600
     tgcgctttta caggtgcatt aacactctat tactatttta tcggcttctt tgggatactt       660
     gccgcgatag ctataacgct tgtctggcaa aggcatacgc gtttttttca ttag             714
//

If you have problems or comments...

PBIL Back to PBIL home page