(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBHT

CP001396.YBHT        Location/Qualifiers
FT   CDS_pept        696964..697113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhT"
FT                   /locus_tag="BWG_0614"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0762"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64956"
FT                   /protein_id="ACR64956.1"
FT                   /translation="MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQP
FT                   GQNH"
     atgttagagt tattaaaaag tctggtattc gccgtaatca tggtacctgt cgtgatggcc        60
     atcatcctgg gtctgattta cggtcttggt gaagtattca acatcttttc tggtgttggt       120
     aaaaaagacc agcccggaca aaatcattga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page