(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBII

CP001396.YBII        Location/Qualifiers
FT   CDS_pept        complement(740381..740647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiI"
FT                   /locus_tag="BWG_0656"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0803"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62285"
FT                   /protein_id="ACR62285.1"
FT                   /translation="MASGWANDDAVNEQINSTIEDAIARARGEIPRGESLDECEECGAP
FT                   IPQARREAIPGVRLCIHCQQEKDLQKPAYTGYNRRGSKDSQLR"
     atggcatccg gttgggctaa cgatgacgcc gtcaacgaac agatcaacag tacaattgaa        60
     gatgcgattg cccgcgctcg gggtgaaatt ccgcgcggcg aaagcctgga tgaatgtgaa       120
     gagtgcggtg cccccatccc gcaggcccgt cgggaagcca ttcctggcgt gcgcttatgt       180
     attcattgtc agcaggagaa agatttacaa aaaccagctt atacaggata taatcgcaga       240
     ggttcgaaag acagccagtt acgttaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page