(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBIX

CP001396.YBIX        Location/Qualifiers
FT   CDS_pept        complement(740721..741398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiX"
FT                   /locus_tag="BWG_0657"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0804"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62286"
FT                   /db_xref="GOA:C4ZXX6"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZXX6"
FT                   /protein_id="ACR62286.1"
FT                   /translation="MMYHIPGVLSPQDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQ
FT                   VDTRSTLYAALQNEVLNAVNQHALFFAAALPRTLSTPLFNRYQNNETYGFHVDGAVRSH
FT                   PQNGWMRTDLSATLFLSDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPV
FT                   TRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQSLKSRYGESEEILSLLNLYHNLLREW
FT                   SEI"
     atgatgtacc acattcccgg cgtgttatcg ccacaggacg tcgctcgttt tcgcgaacaa        60
     ctggaacaag ccgaatgggt ggatggacgc gtcaccaccg gcgcacaagg tgcgcaagtt       120
     aagaacaatc aacaggtcga cacccgcagc acgttatacg ccgccctgca aaatgaggtg       180
     ctgaacgcgg ttaaccaaca tgctttattc tttgccgcgg ccttgccgcg taccctttcc       240
     acgccgctgt ttaatcgcta tcagaacaat gaaacctatg gtttccatgt ggatggcgca       300
     gtacgcagcc atccacaaaa cggctggatg cgtactgacc tttctgccac gctgttttta       360
     agcgatccac aaagctacga cggcggcgaa ctggtcgtta atgacacctt cggacaacat       420
     cgggtaaaac tcccggcagg cgatctcgtg ttgtatccct ccagcagcct gcattgcgtg       480
     acacccgtaa cccgcggcgt acgagtggca tcatttatgt ggatccagtc gatgatccgc       540
     gatgataaaa agcgcgccat gctgtttgaa ctggacaaca atattcagtc gctgaaaagc       600
     cgctacggcg aaagtgaaga gatcctgtcg ctgcttaatc tttatcataa tctgctgcgg       660
     gaatggtcgg agatctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page