(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBJC

CP001396.YBJC        Location/Qualifiers
FT   CDS_pept        793104..793391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjC"
FT                   /locus_tag="BWG_0703"
FT                   /product="predicted inner membrane protein"
FT                   /note="MG1655 equivalent: b0850"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64538"
FT                   /protein_id="ACR64538.1"
FT                   /translation="MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQ
FT                   ILMIFLGVLLMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDNDANH"
     atgcgcgcga tcggtaaatt gcctaaaggc gtgttgatac tggaatttat cggaatgatg        60
     ctactggcgg tggcgctgct gtcggtaagc gactccctgt cgctgcctga gccattttct       120
     cggccagaag tgcagattct gatgattttt ctcggtgttt tgctcatgct tcccgctgcg       180
     gtggtggtta ttcttcaggt ggcaaaacgt cttgccccac agctgatgaa ccgtccaccg       240
     caatattcac gttcagaaag agaaaaagat aatgacgcca accattga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page