(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBJO

CP001396.YBJO        Location/Qualifiers
FT   CDS_pept        800180..800668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjO"
FT                   /locus_tag="BWG_0711"
FT                   /product="predicted inner membrane protein"
FT                   /note="MG1655 equivalent: b0858"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64539"
FT                   /protein_id="ACR64539.1"
FT                   /translation="MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFN
FT                   TLGVRGIGEFIHRSVQTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITA
FT                   ASYLWAASLGYGYPELFSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ"
     atggaagacg aaacgttggg attttttaag aaaacatctt catctcatgc tcgcctgaat        60
     gtgcctgcgc tggtgcaggt ggcggcgctc gccattatta tgatccgtgg cctcgacgtg       120
     ctgatgattt tcaatacgct gggcgtgcgc ggtattggcg agttcattca tcgcagcgta       180
     caaacctgga gtttaacgct ggtcttttta agcagtctgg tgctggtttt cattgagatc       240
     tggtgtgcgt tttcactggt gaaagggcgt cgctgggcgc gctggctata tctgctgaca       300
     caaatcaccg ccgcaagtta cttgtgggcg gcttcgctgg ggtacggtta tccggagctg       360
     ttcagcattc ccggtgaatc aaaacgtgaa atcttccata gcctgatgct gcagaagctg       420
     ccggatatgc tcatcctgat gctgctgttc gttccctcga ccagtcggcg gttcttccag       480
     ttgcaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page