(data stored in SCRATCH3701 zone)

EMBL: CP001396.YKFB

CP001396.YKFB        Location/Qualifiers
FT   CDS_pept        complement(264843..265310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfB"
FT                   /locus_tag="BWG_0232"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /note="MG1655 equivalent: b0250"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62647"
FT                   /protein_id="ACR62647.1"
FT                   /translation="MTILSLSRFMLAGVLLASFNASAIPGFWQQGYGQGNTEYSVTEAS
FT                   GKTFTINCTGNPDQNGFYQHSVFLTLADDKMVSSHDDDTTITVVMDHQQYIIPSSLGWR
FT                   NGDNAWFDFISNISEAGQFDVYVNDHKAGTFTADRKNAEKVLSTLGDCSND"
     atgacaatac tttcactaag tcggtttatg ctggcgggtg tactgctcgc gagctttaat        60
     gcctctgcta tcccggggtt ctggcagcag ggttacggtc agggcaatac ggaatacagc       120
     gtgaccgaag ccagcggaaa gacgtttacc atcaactgca cagggaaccc ggaccagaat       180
     ggtttctatc agcattcagt ctttcttacc cttgccgatg acaagatggt cagttcgcac       240
     gatgacgaca ctactatcac cgtagtgatg gatcaccagc agtacattat tccgtccagc       300
     ctgggctggc gtaacggcga taacgcctgg tttgacttca tcagcaatat ctctgaggcc       360
     gggcagttcg acgtctacgt caatgaccac aaagcaggga ccttcactgc ggaccggaag       420
     aacgctgaga aagttctgtc cactctcgga gactgcagca acgactga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page