(data stored in SCRATCH3701 zone)

EMBL: CP001396.YLIE

CP001396.YLIE        Location/Qualifiers
FT   CDS_pept        775170..777518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yliE"
FT                   /locus_tag="BWG_0686"
FT                   /product="conserved inner membrane protein"
FT                   /note="MG1655 equivalent: b0833"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62211"
FT                   /protein_id="ACR62211.1"
FT                   /translation="MLSLYEKIKIRLIILFLLAALSFIGLFFIINYQLVSERAVKRADS
FT                   RFELIQKNVGYFFKDIERSALTLKDSLYLLKNTEEIQRAVILKMEMMPFLDSVGLVLDD
FT                   NKYYLFSRRANDKIVVYHQEQVNGPLVDESGRVIFADFNPSKRPWSVASDDSNNSWNPA
FT                   YNCFDRPGKKCISFTLHINGKDHDLLAVDKIHVDLNWRYLNEYLDQISANDEVLFLKQG
FT                   HEIIAKNQLAREKLIIYNSEGNYNIIDSVDTEYIEKTSAVPNNALFEIYFYYPGGNLLN
FT                   ASDKLFYLPFAFIIIVLLVVYLMTTRVFRRQFSEMTELVNTLAFLPDSTDQIEALKIRE
FT                   GDAKEIISIKNSIAEMKDAEIERSNKLLSLISYDQESGFIKNMAIIESNNNQYLAVGII
FT                   KLCGLEAVEAVFGVDERNKIVRKLCQRIAEKYAQCCDIVTFNADLYLLLCRENVQTFTR
FT                   KIAMVNDFDSSFGYRNLRIHKSAICEPLQGENAWSYAEKLKLAISSIRDHMFSEFIFCD
FT                   DAKLNEIEENIWIARNIRHAMEIGELFLVYQPIVDINTRAILGAEALCRWVSAERGIIS
FT                   PLKFITIAEDIGFINELGYQIIKTAMGEFRHFSQRASLKDDFLLHINVSPWQLNEPHFH
FT                   ERFTTIMKENGLKANSLCVEITETVIERINEHFYLNIEQLRKQGVRISIDDFGTGLSNL
FT                   KRFYEINPDSIKVDSQFTGDIFGTAGKIVRIIFDLARYNRIPVIAEGVESEDVARELIK
FT                   LGCVQAQGYLYQKPMPFSAWDKSGKLVKE"
     atgctgagtt tatacgaaaa gataaagata aggctgataa ttttattttt attggcagca        60
     ctgtcattta ttggtctttt tttcatcatt aactatcaac tggtatcgga gcgcgcggta       120
     aaacgtgccg atagccgctt tgaacttatt cagaaaaacg ttggctattt ctttaaagat       180
     attgaacgtt cggccctgac attaaaggac tcactgtatt tattaaaaaa tacagaggag       240
     attcaacgcg ccgtgattct taaaatggaa atgatgccat ttttagactc ggtgggactg       300
     gtacttgatg ataataaata ttatcttttt tcgcggaggg cgaatgataa aatcgttgtt       360
     tatcatcagg aacaagtaaa tggaccgctt gtcgacgagt cagggcgggt tatttttgcc       420
     gattttaacc catcgaaacg accgtggtcg gtggcttcag atgactctaa caacagctgg       480
     aatccggcat acaattgctt tgatcgtccg ggtaaaaaat gtatctcttt tacgctacac       540
     atcaacggca aagatcacga tttgttagcg gtggataaaa ttcatgtcga tttaaactgg       600
     cgatatctga acgagtatct tgatcaaatc agcgctaatg atgaagttct atttttgaaa       660
     caaggccatg agatcattgc caagaatcaa ctcgctcgtg aaaaactgat tatttataat       720
     agcgaaggta attataatat tattgattct gtcgatactg aatatatcga aaaaacatca       780
     gcggtgccaa acaacgcatt attcgaaatc tatttttatt atcctggcgg taatttattg       840
     aacgcatcag ataaactttt ttatctgccg tttgcgttca ttattatcgt attgctggtg       900
     gtttatttaa tgaccactcg tgtgttccgt cggcaatttt ctgaaatgac agagctggtt       960
     aatacgctgg cgtttttgcc tgactcaacg gatcaaatcg aggctctgaa aattcgtgaa      1020
     ggcgatgcga aagagattat cagcatcaaa aattcgatcg cggaaatgaa agatgccgaa      1080
     attgaacggt caaataaatt gctctcactg atctcttacg atcaggaaag tggttttatt      1140
     aaaaatatgg cgattattga gtctaacaat aatcagtatc tggctgtggg gatcatcaaa      1200
     ctgtgtggtc tggaagccgt ggaagcggtg tttggtgttg atgagcgcaa taaaatcgtc      1260
     aggaaattgt gtcagcgaat tgccgagaaa tatgcgcaat gctgcgatat cgtgacattc      1320
     aatgccgatc tctatttact tctgtgtcgg gaaaatgtac agacatttac ccgtaaaata      1380
     gcgatggtaa acgattttga cagcagcttt ggctaccgca atctgcgcat ccataagtct      1440
     gccatttgtg aacctttgca gggggaaaac gcctggagtt acgcagaaaa actgaaactg      1500
     gcgatttcca gtatccgtga ccatatgttc tcagagttta ttttctgtga tgacgcgaaa      1560
     ctcaacgaaa tagaagagaa tatctggatt gcgcgtaata ttcgccatgc aatggaaatt      1620
     ggcgaactat tcctcgtcta tcaaccgatc gttgatatta acacccgcgc cattctgggc      1680
     gcggaggcgt tgtgccgttg ggtgtctgcg gagcggggga tcatttcacc gctgaagttc      1740
     attaccattg ctgaagatat cgggtttatc aatgagctgg gttatcagat tattaaaacg      1800
     gcaatgggtg aattcagaca ttttagtcag cgtgcgtcgc tgaaggatga tttcttactg      1860
     catattaatg tttcgccctg gcagttaaac gaaccacact ttcatgagcg ttttaccacc      1920
     atcatgaaag aaaatggcct gaaggcgaac agcctctgtg ttgagatcac tgaaaccgtg      1980
     atcgagcgaa ttaatgaaca tttttatctc aatattgaac aactgcgtaa acaaggggta      2040
     cggatatcga ttgatgactt tggcaccggt ttgtcaaacc tgaaacgttt ttatgaaatt      2100
     aatccagaca gcataaaggt ggactcgcaa ttcaccggcg atattttcgg tactgcggga      2160
     aaaattgtgc gcattatttt cgacctggca cgctataacc ggatcccggt gattgcggaa      2220
     ggcgtagaga gcgaagacgt tgcgcgcgaa ttaatcaaat taggatgtgt tcaggctcag      2280
     gggtatctgt accagaaacc catgccattc tccgcctggg ataaaagtgg aaaattagta      2340
     aaagagtag                                                              2349
//

If you have problems or comments...

PBIL Back to PBIL home page