(data stored in ACNUC7421 zone)

EMBL: CP001402

ID   CP001402; SV 1; circular; genomic DNA; STD; PRO; 2586647 BP.
AC   CP001402;
PR   Project:PRJNA18807;
DT   31-MAY-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
DE   Sulfolobus islandicus M.16.4, complete genome.
KW   .
OS   Sulfolobus islandicus M.16.4
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
RN   [1]
RP   1-2586647
RX   DOI; 10.1073/pnas.0808945106.
RX   PUBMED; 19435847.
RA   Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.;
RT   "Biogeography of the Sulfolobus islandicus pan-genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(21):8605-8610(2009).
RN   [2]
RP   1-2586647
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Meineke L., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Anderson I., Whitaker R.J., Richardson P.;
RT   ;
RL   Submitted (30-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; 615404661ec56d6e8d29ce28ddac4889.
DR   BioSample; SAMN02598414.
DR   EnsemblGenomes-Gn; EBG00001131688.
DR   EnsemblGenomes-Gn; EBG00001131689.
DR   EnsemblGenomes-Gn; EBG00001131690.
DR   EnsemblGenomes-Gn; EBG00001131691.
DR   EnsemblGenomes-Gn; EBG00001131692.
DR   EnsemblGenomes-Gn; EBG00001131693.
DR   EnsemblGenomes-Gn; EBG00001131694.
DR   EnsemblGenomes-Gn; EBG00001131695.
DR   EnsemblGenomes-Gn; EBG00001131696.
DR   EnsemblGenomes-Gn; EBG00001131697.
DR   EnsemblGenomes-Gn; EBG00001131698.
DR   EnsemblGenomes-Gn; EBG00001131699.
DR   EnsemblGenomes-Gn; EBG00001131700.
DR   EnsemblGenomes-Gn; EBG00001131701.
DR   EnsemblGenomes-Gn; EBG00001131702.
DR   EnsemblGenomes-Gn; EBG00001131703.
DR   EnsemblGenomes-Gn; EBG00001131704.
DR   EnsemblGenomes-Gn; EBG00001131705.
DR   EnsemblGenomes-Gn; EBG00001131706.
DR   EnsemblGenomes-Gn; EBG00001131707.
DR   EnsemblGenomes-Gn; EBG00001131708.
DR   EnsemblGenomes-Gn; EBG00001131709.
DR   EnsemblGenomes-Gn; EBG00001131710.
DR   EnsemblGenomes-Gn; EBG00001131711.
DR   EnsemblGenomes-Gn; EBG00001131712.
DR   EnsemblGenomes-Gn; EBG00001131714.
DR   EnsemblGenomes-Gn; EBG00001131715.
DR   EnsemblGenomes-Gn; EBG00001131716.
DR   EnsemblGenomes-Gn; EBG00001131717.
DR   EnsemblGenomes-Gn; EBG00001131718.
DR   EnsemblGenomes-Gn; EBG00001131719.
DR   EnsemblGenomes-Gn; EBG00001131720.
DR   EnsemblGenomes-Gn; EBG00001131721.
DR   EnsemblGenomes-Gn; EBG00001131722.
DR   EnsemblGenomes-Gn; EBG00001131723.
DR   EnsemblGenomes-Gn; EBG00001131724.
DR   EnsemblGenomes-Gn; EBG00001131725.
DR   EnsemblGenomes-Gn; EBG00001131726.
DR   EnsemblGenomes-Gn; EBG00001131727.
DR   EnsemblGenomes-Gn; EBG00001131728.
DR   EnsemblGenomes-Gn; EBG00001131729.
DR   EnsemblGenomes-Gn; EBG00001131730.
DR   EnsemblGenomes-Gn; EBG00001131731.
DR   EnsemblGenomes-Gn; EBG00001131732.
DR   EnsemblGenomes-Gn; EBG00001131733.
DR   EnsemblGenomes-Gn; EBG00001131734.
DR   EnsemblGenomes-Gn; EBG00001131735.
DR   EnsemblGenomes-Gn; EBG00001131736.
DR   EnsemblGenomes-Gn; EBG00001131737.
DR   EnsemblGenomes-Gn; EBG00001131738.
DR   EnsemblGenomes-Gn; EBG00001131739.
DR   EnsemblGenomes-Gn; EBG00001131740.
DR   EnsemblGenomes-Gn; EBG00001131741.
DR   EnsemblGenomes-Gn; EBG00001131742.
DR   EnsemblGenomes-Gn; EBG00001131743.
DR   EnsemblGenomes-Gn; EBG00001131744.
DR   EnsemblGenomes-Gn; EBG00001131745.
DR   EnsemblGenomes-Gn; EBG00001131746.
DR   EnsemblGenomes-Gn; EBG00001131747.
DR   EnsemblGenomes-Gn; EBG00001131748.
DR   EnsemblGenomes-Gn; EBG00001131749.
DR   EnsemblGenomes-Gn; EBG00001131750.
DR   EnsemblGenomes-Gn; EBG00001131751.
DR   EnsemblGenomes-Gn; M164_R0001.
DR   EnsemblGenomes-Gn; M164_R0002.
DR   EnsemblGenomes-Gn; M164_R0003.
DR   EnsemblGenomes-Gn; M164_R0004.
DR   EnsemblGenomes-Gn; M164_R0005.
DR   EnsemblGenomes-Gn; M164_R0006.
DR   EnsemblGenomes-Gn; M164_R0007.
DR   EnsemblGenomes-Gn; M164_R0008.
DR   EnsemblGenomes-Gn; M164_R0009.
DR   EnsemblGenomes-Gn; M164_R0010.
DR   EnsemblGenomes-Gn; M164_R0011.
DR   EnsemblGenomes-Gn; M164_R0012.
DR   EnsemblGenomes-Gn; M164_R0013.
DR   EnsemblGenomes-Gn; M164_R0014.
DR   EnsemblGenomes-Gn; M164_R0015.
DR   EnsemblGenomes-Gn; M164_R0016.
DR   EnsemblGenomes-Gn; M164_R0017.
DR   EnsemblGenomes-Gn; M164_R0018.
DR   EnsemblGenomes-Gn; M164_R0019.
DR   EnsemblGenomes-Gn; M164_R0020.
DR   EnsemblGenomes-Gn; M164_R0021.
DR   EnsemblGenomes-Gn; M164_R0022.
DR   EnsemblGenomes-Gn; M164_R0023.
DR   EnsemblGenomes-Gn; M164_R0024.
DR   EnsemblGenomes-Gn; M164_R0025.
DR   EnsemblGenomes-Gn; M164_R0026.
DR   EnsemblGenomes-Gn; M164_R0027.
DR   EnsemblGenomes-Gn; M164_R0028.
DR   EnsemblGenomes-Gn; M164_R0029.
DR   EnsemblGenomes-Gn; M164_R0030.
DR   EnsemblGenomes-Gn; M164_R0031.
DR   EnsemblGenomes-Gn; M164_R0032.
DR   EnsemblGenomes-Gn; M164_R0033.
DR   EnsemblGenomes-Gn; M164_R0034.
DR   EnsemblGenomes-Gn; M164_R0035.
DR   EnsemblGenomes-Gn; M164_R0036.
DR   EnsemblGenomes-Gn; M164_R0037.
DR   EnsemblGenomes-Gn; M164_R0038.
DR   EnsemblGenomes-Gn; M164_R0039.
DR   EnsemblGenomes-Gn; M164_R0040.
DR   EnsemblGenomes-Gn; M164_R0041.
DR   EnsemblGenomes-Gn; M164_R0042.
DR   EnsemblGenomes-Gn; M164_R0043.
DR   EnsemblGenomes-Gn; M164_R0044.
DR   EnsemblGenomes-Gn; M164_R0045.
DR   EnsemblGenomes-Gn; M164_R0046.
DR   EnsemblGenomes-Gn; M164_R0047.
DR   EnsemblGenomes-Gn; M164_R0048.
DR   EnsemblGenomes-Gn; M164_R0049.
DR   EnsemblGenomes-Gn; M164_R0050.
DR   EnsemblGenomes-Gn; M164_R0051.
DR   EnsemblGenomes-Tr; EBT00001722719.
DR   EnsemblGenomes-Tr; EBT00001722720.
DR   EnsemblGenomes-Tr; EBT00001722721.
DR   EnsemblGenomes-Tr; EBT00001722722.
DR   EnsemblGenomes-Tr; EBT00001722723.
DR   EnsemblGenomes-Tr; EBT00001722724.
DR   EnsemblGenomes-Tr; EBT00001722725.
DR   EnsemblGenomes-Tr; EBT00001722726.
DR   EnsemblGenomes-Tr; EBT00001722727.
DR   EnsemblGenomes-Tr; EBT00001722728.
DR   EnsemblGenomes-Tr; EBT00001722729.
DR   EnsemblGenomes-Tr; EBT00001722730.
DR   EnsemblGenomes-Tr; EBT00001722731.
DR   EnsemblGenomes-Tr; EBT00001722732.
DR   EnsemblGenomes-Tr; EBT00001722733.
DR   EnsemblGenomes-Tr; EBT00001722734.
DR   EnsemblGenomes-Tr; EBT00001722735.
DR   EnsemblGenomes-Tr; EBT00001722736.
DR   EnsemblGenomes-Tr; EBT00001722737.
DR   EnsemblGenomes-Tr; EBT00001722738.
DR   EnsemblGenomes-Tr; EBT00001722739.
DR   EnsemblGenomes-Tr; EBT00001722740.
DR   EnsemblGenomes-Tr; EBT00001722741.
DR   EnsemblGenomes-Tr; EBT00001722742.
DR   EnsemblGenomes-Tr; EBT00001722743.
DR   EnsemblGenomes-Tr; EBT00001722744.
DR   EnsemblGenomes-Tr; EBT00001722745.
DR   EnsemblGenomes-Tr; EBT00001722746.
DR   EnsemblGenomes-Tr; EBT00001722747.
DR   EnsemblGenomes-Tr; EBT00001722748.
DR   EnsemblGenomes-Tr; EBT00001722749.
DR   EnsemblGenomes-Tr; EBT00001722750.
DR   EnsemblGenomes-Tr; EBT00001722751.
DR   EnsemblGenomes-Tr; EBT00001722752.
DR   EnsemblGenomes-Tr; EBT00001722753.
DR   EnsemblGenomes-Tr; EBT00001722754.
DR   EnsemblGenomes-Tr; EBT00001722755.
DR   EnsemblGenomes-Tr; EBT00001722756.
DR   EnsemblGenomes-Tr; EBT00001722757.
DR   EnsemblGenomes-Tr; EBT00001722758.
DR   EnsemblGenomes-Tr; EBT00001722759.
DR   EnsemblGenomes-Tr; EBT00001722760.
DR   EnsemblGenomes-Tr; EBT00001722761.
DR   EnsemblGenomes-Tr; EBT00001722762.
DR   EnsemblGenomes-Tr; EBT00001722763.
DR   EnsemblGenomes-Tr; EBT00001722764.
DR   EnsemblGenomes-Tr; EBT00001722765.
DR   EnsemblGenomes-Tr; EBT00001722766.
DR   EnsemblGenomes-Tr; EBT00001722767.
DR   EnsemblGenomes-Tr; EBT00001722768.
DR   EnsemblGenomes-Tr; EBT00001722769.
DR   EnsemblGenomes-Tr; EBT00001722770.
DR   EnsemblGenomes-Tr; EBT00001722771.
DR   EnsemblGenomes-Tr; EBT00001722772.
DR   EnsemblGenomes-Tr; EBT00001722773.
DR   EnsemblGenomes-Tr; EBT00001722775.
DR   EnsemblGenomes-Tr; EBT00001722776.
DR   EnsemblGenomes-Tr; EBT00001722777.
DR   EnsemblGenomes-Tr; EBT00001722778.
DR   EnsemblGenomes-Tr; EBT00001722779.
DR   EnsemblGenomes-Tr; EBT00001722780.
DR   EnsemblGenomes-Tr; EBT00001722781.
DR   EnsemblGenomes-Tr; EBT00001722782.
DR   EnsemblGenomes-Tr; M164_R0001-1.
DR   EnsemblGenomes-Tr; M164_R0002-1.
DR   EnsemblGenomes-Tr; M164_R0003-1.
DR   EnsemblGenomes-Tr; M164_R0004-1.
DR   EnsemblGenomes-Tr; M164_R0005-1.
DR   EnsemblGenomes-Tr; M164_R0006-1.
DR   EnsemblGenomes-Tr; M164_R0007-1.
DR   EnsemblGenomes-Tr; M164_R0008-1.
DR   EnsemblGenomes-Tr; M164_R0009-1.
DR   EnsemblGenomes-Tr; M164_R0010-1.
DR   EnsemblGenomes-Tr; M164_R0011-1.
DR   EnsemblGenomes-Tr; M164_R0012-1.
DR   EnsemblGenomes-Tr; M164_R0013-1.
DR   EnsemblGenomes-Tr; M164_R0014-1.
DR   EnsemblGenomes-Tr; M164_R0015-1.
DR   EnsemblGenomes-Tr; M164_R0016-1.
DR   EnsemblGenomes-Tr; M164_R0017-1.
DR   EnsemblGenomes-Tr; M164_R0018-1.
DR   EnsemblGenomes-Tr; M164_R0019-1.
DR   EnsemblGenomes-Tr; M164_R0020-1.
DR   EnsemblGenomes-Tr; M164_R0021-1.
DR   EnsemblGenomes-Tr; M164_R0022-1.
DR   EnsemblGenomes-Tr; M164_R0023-1.
DR   EnsemblGenomes-Tr; M164_R0024-1.
DR   EnsemblGenomes-Tr; M164_R0025-1.
DR   EnsemblGenomes-Tr; M164_R0026-1.
DR   EnsemblGenomes-Tr; M164_R0027-1.
DR   EnsemblGenomes-Tr; M164_R0028-1.
DR   EnsemblGenomes-Tr; M164_R0029-1.
DR   EnsemblGenomes-Tr; M164_R0030-1.
DR   EnsemblGenomes-Tr; M164_R0031-1.
DR   EnsemblGenomes-Tr; M164_R0032-1.
DR   EnsemblGenomes-Tr; M164_R0033-1.
DR   EnsemblGenomes-Tr; M164_R0034-1.
DR   EnsemblGenomes-Tr; M164_R0035-1.
DR   EnsemblGenomes-Tr; M164_R0036-1.
DR   EnsemblGenomes-Tr; M164_R0037-1.
DR   EnsemblGenomes-Tr; M164_R0038-1.
DR   EnsemblGenomes-Tr; M164_R0039-1.
DR   EnsemblGenomes-Tr; M164_R0040-1.
DR   EnsemblGenomes-Tr; M164_R0041-1.
DR   EnsemblGenomes-Tr; M164_R0042-1.
DR   EnsemblGenomes-Tr; M164_R0043-1.
DR   EnsemblGenomes-Tr; M164_R0044-1.
DR   EnsemblGenomes-Tr; M164_R0045-1.
DR   EnsemblGenomes-Tr; M164_R0046-1.
DR   EnsemblGenomes-Tr; M164_R0047-1.
DR   EnsemblGenomes-Tr; M164_R0048-1.
DR   EnsemblGenomes-Tr; M164_R0049-1.
DR   EnsemblGenomes-Tr; M164_R0050-1.
DR   EnsemblGenomes-Tr; M164_R0051-1.
DR   EuropePMC; PMC5127849; 27965637.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01140; sR20.
DR   RFAM; RF01145; sR14.
DR   RFAM; RF01148; sR13.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01304; sR5.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001402.
DR   SILVA-SSU; CP001402.
CC   URL -- http://www.jgi.doe.gov
CC          http://www.life.uiuc.edu/S.islandicus
CC   JGI Project ID: 4023464
CC   Source DNA and archaea available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC    Organism display name:  Sulfolobus islandicus M.16.4
CC    GOLD ID:  Gi01314 http://genomesonline.org/GOLD_CARDS/Gi01314.html
CC    Sequencing Status:  Complete
CC    Phenotypes:  Acidophile
CC    Diseases:  None
CC    Habitat:  Fresh water
CC    Oxygen Requirement:  Aerobe
CC    Cell Shape:  Coccus-shaped
CC    Motility:  Nonmotile
CC    Sporulation:  Nonsporulating
CC    Energy Source:  Lithotroph
CC    Temperature Range:  Thermophile
CC    Biotic Relationship:  Free living
CC    Isolation:  Hot spring on the Kamchatka Penninsula in the Russian
CC   Far East.
FH   Key             Location/Qualifiers
FT   source          1..2586647
FT                   /organism="Sulfolobus islandicus M.16.4"
FT                   /strain="M.16.4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:426118"
FT   gene            471..767
FT                   /locus_tag="M164_0001"
FT   CDS_pept        471..767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40637"
FT                   /db_xref="GOA:C4KJB7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB7"
FT                   /protein_id="ACR40637.1"
FT   gene            842..2029
FT                   /locus_tag="M164_0002"
FT   CDS_pept        842..2029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40638"
FT                   /db_xref="GOA:C4KJB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB8"
FT                   /protein_id="ACR40638.1"
FT   gene            2010..2330
FT                   /locus_tag="M164_0003"
FT   CDS_pept        2010..2330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0003"
FT                   /product="conserved hypothetical M protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40639"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB9"
FT                   /protein_id="ACR40639.1"
FT                   DY"
FT   gene            2400..3233
FT                   /locus_tag="M164_0004"
FT   CDS_pept        2400..3233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0004"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40640"
FT                   /db_xref="GOA:C4KJC0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC0"
FT                   /protein_id="ACR40640.1"
FT   gene            3281..3580
FT                   /locus_tag="M164_0005"
FT   CDS_pept        3281..3580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0005"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40641"
FT                   /db_xref="GOA:C4KJC1"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJC1"
FT                   /protein_id="ACR40641.1"
FT   gene            complement(3648..4226)
FT                   /locus_tag="M164_0006"
FT   CDS_pept        complement(3648..4226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40642"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC2"
FT                   /protein_id="ACR40642.1"
FT   gene            complement(4154..4867)
FT                   /locus_tag="M164_0007"
FT   CDS_pept        complement(4154..4867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40643"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC3"
FT                   /protein_id="ACR40643.1"
FT                   QPYLQVEIGRKRRKR"
FT   gene            complement(4901..5728)
FT                   /locus_tag="M164_0008"
FT   CDS_pept        complement(4901..5728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC4"
FT                   /protein_id="ACR40644.1"
FT   gene            complement(6219..7049)
FT                   /locus_tag="M164_0009"
FT   CDS_pept        complement(6219..7049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0009"
FT                   /product="AIG2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40645"
FT                   /db_xref="GOA:C4KJC5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC5"
FT                   /protein_id="ACR40645.1"
FT   gene            complement(7052..7336)
FT                   /locus_tag="M164_0010"
FT   CDS_pept        complement(7052..7336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40646"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC6"
FT                   /protein_id="ACR40646.1"
FT   gene            complement(7317..7691)
FT                   /locus_tag="M164_0011"
FT   CDS_pept        complement(7317..7691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0011"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40647"
FT                   /db_xref="GOA:C4KJC7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC7"
FT                   /protein_id="ACR40647.1"
FT   gene            7727..9055
FT                   /locus_tag="M164_0012"
FT   CDS_pept        7727..9055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0012"
FT                   /product="Peptidase A5, thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40648"
FT                   /db_xref="GOA:C4KJC8"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC8"
FT                   /protein_id="ACR40648.1"
FT   sig_peptide     7727..7819
FT                   /locus_tag="M164_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.483 at
FT                   residue 31"
FT   gene            9080..9883
FT                   /locus_tag="M164_0013"
FT   CDS_pept        9080..9883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0013"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40649"
FT                   /db_xref="GOA:C4KJC9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC9"
FT                   /protein_id="ACR40649.1"
FT   gene            complement(9914..11005)
FT                   /locus_tag="M164_0014"
FT   CDS_pept        complement(9914..11005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40650"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD0"
FT                   /protein_id="ACR40650.1"
FT   gene            complement(11002..11691)
FT                   /locus_tag="M164_0015"
FT   CDS_pept        complement(11002..11691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40651"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD1"
FT                   /protein_id="ACR40651.1"
FT                   ISIKVKV"
FT   gene            complement(11678..14716)
FT                   /locus_tag="M164_0016"
FT   CDS_pept        complement(11678..14716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40652"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD2"
FT                   /protein_id="ACR40652.1"
FT   gene            complement(14721..16334)
FT                   /locus_tag="M164_0017"
FT   CDS_pept        complement(14721..16334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0017"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40653"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD3"
FT                   /protein_id="ACR40653.1"
FT   gene            complement(16379..16945)
FT                   /locus_tag="M164_0018"
FT   CDS_pept        complement(16379..16945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40654"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD4"
FT                   /protein_id="ACR40654.1"
FT   gene            complement(16917..17801)
FT                   /locus_tag="M164_0019"
FT   CDS_pept        complement(16917..17801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40655"
FT                   /db_xref="GOA:C4KJD5"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD5"
FT                   /protein_id="ACR40655.1"
FT                   EEEVNELCMRATI"
FT   gene            18044..18724
FT                   /locus_tag="M164_0020"
FT   CDS_pept        18044..18724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40656"
FT                   /db_xref="GOA:C4KJD6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD6"
FT                   /protein_id="ACR40656.1"
FT                   DTNV"
FT   gene            18766..20697
FT                   /locus_tag="M164_0021"
FT   CDS_pept        18766..20697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0021"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40657"
FT                   /db_xref="GOA:C4KJD7"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD7"
FT                   /protein_id="ACR40657.1"
FT                   KQLLKTKL"
FT   gene            20709..21428
FT                   /locus_tag="M164_0022"
FT   CDS_pept        20709..21428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0022"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40658"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD8"
FT                   /protein_id="ACR40658.1"
FT                   DWVDGVVIPAHGGARLK"
FT   gene            21429..22070
FT                   /locus_tag="M164_0023"
FT   CDS_pept        21429..22070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0023"
FT                   /product="transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40659"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD9"
FT                   /protein_id="ACR40659.1"
FT   gene            22073..22735
FT                   /locus_tag="M164_0024"
FT   CDS_pept        22073..22735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40660"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE0"
FT                   /protein_id="ACR40660.1"
FT   gene            complement(22729..23460)
FT                   /locus_tag="M164_0025"
FT   CDS_pept        complement(22729..23460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0025"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40661"
FT                   /db_xref="GOA:C4KJE1"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE1"
FT                   /protein_id="ACR40661.1"
FT   gene            23494..24552
FT                   /locus_tag="M164_0026"
FT   CDS_pept        23494..24552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0026"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40662"
FT                   /db_xref="GOA:C4KJE2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE2"
FT                   /protein_id="ACR40662.1"
FT                   GKRYIVKPLREK"
FT   gene            24676..25239
FT                   /locus_tag="M164_0027"
FT   CDS_pept        24676..25239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE3"
FT                   /protein_id="ACR40663.1"
FT   gene            25264..26316
FT                   /locus_tag="M164_0028"
FT   CDS_pept        25264..26316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0028"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40664"
FT                   /db_xref="GOA:C4KJE4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE4"
FT                   /protein_id="ACR40664.1"
FT                   PLLDSTEIIP"
FT   gene            26342..27037
FT                   /locus_tag="M164_0029"
FT   CDS_pept        26342..27037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40665"
FT                   /db_xref="GOA:C4KJE5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE5"
FT                   /protein_id="ACR40665.1"
FT                   LVNLILKIS"
FT   gene            complement(27167..28210)
FT                   /locus_tag="M164_0030"
FT   CDS_pept        complement(27167..28210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0030"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazolephosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40666"
FT                   /db_xref="GOA:C4KJE6"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJE6"
FT                   /protein_id="ACR40666.1"
FT                   GSNNLHI"
FT   gene            28274..28603
FT                   /locus_tag="M164_0031"
FT   CDS_pept        28274..28603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40667"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE7"
FT                   /protein_id="ACR40667.1"
FT                   DKYMG"
FT   gene            complement(28609..29739)
FT                   /locus_tag="M164_0032"
FT   CDS_pept        complement(28609..29739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0032"
FT                   /product="aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40668"
FT                   /db_xref="GOA:C4KJE8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE8"
FT                   /protein_id="ACR40668.1"
FT   gene            complement(29711..31423)
FT                   /locus_tag="M164_0033"
FT   CDS_pept        complement(29711..31423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0033"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40669"
FT                   /db_xref="GOA:C4KJE9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJE9"
FT                   /protein_id="ACR40669.1"
FT   gene            complement(31481..31957)
FT                   /locus_tag="M164_0034"
FT   CDS_pept        complement(31481..31957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0034"
FT                   /product="Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40670"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF0"
FT                   /protein_id="ACR40670.1"
FT   gene            complement(31941..32690)
FT                   /locus_tag="M164_0035"
FT   CDS_pept        complement(31941..32690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0035"
FT                   /product="NAD(+) kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40671"
FT                   /db_xref="GOA:C4KJF1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJF1"
FT                   /protein_id="ACR40671.1"
FT   gene            32796..33863
FT                   /locus_tag="M164_0036"
FT   CDS_pept        32796..33863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0036"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40672"
FT                   /db_xref="GOA:C4KJF2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF2"
FT                   /protein_id="ACR40672.1"
FT                   VLFSLIMLVRQNISI"
FT   gene            complement(33841..34194)
FT                   /locus_tag="M164_0037"
FT   CDS_pept        complement(33841..34194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40673"
FT                   /db_xref="GOA:C4KJF3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF3"
FT                   /protein_id="ACR40673.1"
FT                   KVFQVRVKLRYSA"
FT   gene            34279..35277
FT                   /locus_tag="M164_0038"
FT   CDS_pept        34279..35277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0038"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40674"
FT                   /db_xref="GOA:C4KJF4"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF4"
FT                   /protein_id="ACR40674.1"
FT   gene            35299..36039
FT                   /locus_tag="M164_0039"
FT   CDS_pept        35299..36039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0039"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40675"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF5"
FT                   /protein_id="ACR40675.1"
FT   gene            complement(35962..36447)
FT                   /locus_tag="M164_0040"
FT   CDS_pept        complement(35962..36447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0040"
FT                   /product="Protein of unknown function DUF371"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40676"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF6"
FT                   /protein_id="ACR40676.1"
FT   gene            complement(36407..36700)
FT                   /locus_tag="M164_0041"
FT   CDS_pept        complement(36407..36700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0041"
FT                   /product="protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40677"
FT                   /db_xref="GOA:C4KJF7"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF7"
FT                   /protein_id="ACR40677.1"
FT   gene            complement(36660..36974)
FT                   /locus_tag="M164_0042"
FT   CDS_pept        complement(36660..36974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0042"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40678"
FT                   /db_xref="GOA:C4KJF8"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJF8"
FT                   /protein_id="ACR40678.1"
FT                   "
FT   gene            36996..37667
FT                   /locus_tag="M164_0043"
FT   CDS_pept        36996..37667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0043"
FT                   /product="Suppressor Mra1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40679"
FT                   /db_xref="GOA:C4KJF9"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJF9"
FT                   /protein_id="ACR40679.1"
FT                   P"
FT   gene            complement(37648..38223)
FT                   /locus_tag="M164_0044"
FT   CDS_pept        complement(37648..38223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40680"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG0"
FT                   /protein_id="ACR40680.1"
FT   gene            complement(38298..38477)
FT                   /locus_tag="M164_0045"
FT   CDS_pept        complement(38298..38477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40681"
FT                   /db_xref="GOA:C4KJG1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG1"
FT                   /protein_id="ACR40681.1"
FT                   LFIIFDLIAFTPHS"
FT   gene            39052..39936
FT                   /locus_tag="M164_0046"
FT   CDS_pept        39052..39936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0046"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40682"
FT                   /db_xref="GOA:C4KJG2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG2"
FT                   /protein_id="ACR40682.1"
FT                   KKILEQVNTLYSR"
FT   gene            complement(39904..40770)
FT                   /locus_tag="M164_0047"
FT   CDS_pept        complement(39904..40770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0047"
FT                   /product="protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40683"
FT                   /db_xref="GOA:C4KJG3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG3"
FT                   /protein_id="ACR40683.1"
FT                   VKSIDLL"
FT   gene            40874..41404
FT                   /locus_tag="M164_0048"
FT   CDS_pept        40874..41404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0048"
FT                   /product="protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40684"
FT                   /db_xref="GOA:C4KJG4"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG4"
FT                   /protein_id="ACR40684.1"
FT                   YPIYNTMINNTPF"
FT   gene            complement(41385..42038)
FT                   /locus_tag="M164_0049"
FT   CDS_pept        complement(41385..42038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG5"
FT                   /protein_id="ACR40685.1"
FT   gene            complement(42051..42458)
FT                   /locus_tag="M164_0050"
FT   CDS_pept        complement(42051..42458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0050"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40686"
FT                   /db_xref="GOA:C4KJG6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG6"
FT                   /protein_id="ACR40686.1"
FT   gene            42515..43429
FT                   /locus_tag="M164_0051"
FT   CDS_pept        42515..43429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0051"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40687"
FT                   /db_xref="GOA:C4KJG7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG7"
FT                   /protein_id="ACR40687.1"
FT   gene            43419..44132
FT                   /locus_tag="M164_0052"
FT   CDS_pept        43419..44132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0052"
FT                   /product="Protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40688"
FT                   /db_xref="GOA:C4KJG8"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG8"
FT                   /protein_id="ACR40688.1"
FT                   IIAALKSFDIHIQLR"
FT   gene            complement(44097..44729)
FT                   /locus_tag="M164_0053"
FT   CDS_pept        complement(44097..44729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0053"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40689"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG9"
FT                   /protein_id="ACR40689.1"
FT   gene            44798..45775
FT                   /locus_tag="M164_0054"
FT   CDS_pept        44798..45775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0054"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40690"
FT                   /db_xref="GOA:C4KJH0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH0"
FT                   /protein_id="ACR40690.1"
FT   gene            45987..46313
FT                   /locus_tag="M164_0055"
FT   CDS_pept        45987..46313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH1"
FT                   /protein_id="ACR40691.1"
FT                   PWSP"
FT   gene            complement(46315..48078)
FT                   /locus_tag="M164_0056"
FT   CDS_pept        complement(46315..48078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0056"
FT                   /product="BPS2 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40692"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH2"
FT                   /protein_id="ACR40692.1"
FT                   TLPPKQIEISS"
FT   gene            48286..49209
FT                   /locus_tag="M164_0057"
FT   CDS_pept        48286..49209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0057"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40693"
FT                   /db_xref="GOA:C4KJH3"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH3"
FT                   /protein_id="ACR40693.1"
FT   gene            complement(49183..49593)
FT                   /locus_tag="M164_0058"
FT   CDS_pept        complement(49183..49593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0058"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40694"
FT                   /db_xref="GOA:C4KJH4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH4"
FT                   /protein_id="ACR40694.1"
FT   gene            49697..50182
FT                   /locus_tag="M164_0059"
FT   CDS_pept        49697..50182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40695"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH5"
FT                   /protein_id="ACR40695.1"
FT   gene            50160..50837
FT                   /locus_tag="M164_0060"
FT   CDS_pept        50160..50837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0060"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40696"
FT                   /db_xref="GOA:C4KJH6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH6"
FT                   /protein_id="ACR40696.1"
FT                   SKL"
FT   gene            51096..51914
FT                   /locus_tag="M164_0061"
FT   CDS_pept        51096..51914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0061"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40697"
FT                   /db_xref="GOA:C4KJH7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH7"
FT                   /protein_id="ACR40697.1"
FT   gene            complement(51911..52930)
FT                   /locus_tag="M164_0062"
FT   CDS_pept        complement(51911..52930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40698"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH8"
FT                   /protein_id="ACR40698.1"
FT   gene            complement(52927..55521)
FT                   /locus_tag="M164_0063"
FT   CDS_pept        complement(52927..55521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0063"
FT                   /product="Rad50 zinc hook domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40699"
FT                   /db_xref="GOA:C4KJH9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJH9"
FT                   /protein_id="ACR40699.1"
FT   gene            complement(55518..56666)
FT                   /locus_tag="M164_0064"
FT   CDS_pept        complement(55518..56666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0064"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40700"
FT                   /db_xref="GOA:C4KJI0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI0"
FT                   /protein_id="ACR40700.1"
FT   gene            complement(56666..58168)
FT                   /locus_tag="M164_0065"
FT   CDS_pept        complement(56666..58168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0065"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40701"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI1"
FT                   /protein_id="ACR40701.1"
FT   gene            complement(58264..58812)
FT                   /locus_tag="M164_0066"
FT   CDS_pept        complement(58264..58812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40702"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI2"
FT                   /protein_id="ACR40702.1"
FT   gene            59070..60575
FT                   /locus_tag="M164_0067"
FT   CDS_pept        59070..60575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0067"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40703"
FT                   /db_xref="GOA:C4KJI3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI3"
FT                   /protein_id="ACR40703.1"
FT   gene            complement(60567..61016)
FT                   /locus_tag="M164_0068"
FT   CDS_pept        complement(60567..61016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0068"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40704"
FT                   /db_xref="GOA:C4KJI4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI4"
FT                   /protein_id="ACR40704.1"
FT   gene            61097..62632
FT                   /locus_tag="M164_0069"
FT   CDS_pept        61097..62632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0069"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40705"
FT                   /db_xref="GOA:C4KJI5"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJI5"
FT                   /protein_id="ACR40705.1"
FT   gene            62629..63438
FT                   /locus_tag="M164_0070"
FT   CDS_pept        62629..63438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40706"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI6"
FT                   /protein_id="ACR40706.1"
FT   gene            complement(63428..64096)
FT                   /locus_tag="M164_0071"
FT   CDS_pept        complement(63428..64096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0071"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40707"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI7"
FT                   /protein_id="ACR40707.1"
FT                   "
FT   gene            complement(64103..65347)
FT                   /locus_tag="M164_0072"
FT   CDS_pept        complement(64103..65347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0072"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40708"
FT                   /db_xref="GOA:C4KJI8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI8"
FT                   /protein_id="ACR40708.1"
FT                   WTKGDMALEKFLASW"
FT   gene            65481..66074
FT                   /locus_tag="M164_0073"
FT   CDS_pept        65481..66074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40709"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI9"
FT                   /protein_id="ACR40709.1"
FT   gene            66071..66712
FT                   /locus_tag="M164_0074"
FT   CDS_pept        66071..66712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40710"
FT                   /db_xref="InterPro:IPR017139"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ0"
FT                   /protein_id="ACR40710.1"
FT   gene            complement(66701..67648)
FT                   /locus_tag="M164_0075"
FT   CDS_pept        complement(66701..67648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0075"
FT                   /product="LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40711"
FT                   /db_xref="GOA:C4KJJ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ1"
FT                   /protein_id="ACR40711.1"
FT   gene            complement(67638..68063)
FT                   /locus_tag="M164_0076"
FT   CDS_pept        complement(67638..68063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0076"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40712"
FT                   /db_xref="GOA:C4KJJ2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ2"
FT                   /protein_id="ACR40712.1"
FT   gene            68175..68462
FT                   /locus_tag="M164_0077"
FT   CDS_pept        68175..68462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40713"
FT                   /db_xref="GOA:C4KJJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ3"
FT                   /protein_id="ACR40713.1"
FT   gene            complement(68449..68856)
FT                   /locus_tag="M164_0078"
FT   CDS_pept        complement(68449..68856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0078"
FT                   /product="regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40714"
FT                   /db_xref="GOA:C4KJJ4"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ4"
FT                   /protein_id="ACR40714.1"
FT   gene            69064..69603
FT                   /locus_tag="M164_0079"
FT   CDS_pept        69064..69603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40715"
FT                   /db_xref="GOA:C4KJJ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ5"
FT                   /protein_id="ACR40715.1"
FT                   IWNQYNVTYYVLIYYE"
FT   gene            complement(69687..70163)
FT                   /locus_tag="M164_0080"
FT   CDS_pept        complement(69687..70163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40716"
FT                   /db_xref="GOA:C4KJJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ6"
FT                   /protein_id="ACR40716.1"
FT   gene            70253..70558
FT                   /locus_tag="M164_0081"
FT   CDS_pept        70253..70558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40717"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ7"
FT                   /protein_id="ACR40717.1"
FT   gene            complement(70541..71422)
FT                   /locus_tag="M164_0082"
FT   CDS_pept        complement(70541..71422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0082"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40718"
FT                   /db_xref="GOA:C4KJJ8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ8"
FT                   /protein_id="ACR40718.1"
FT                   NRVGVVDLLHFL"
FT   gene            complement(71626..72024)
FT                   /locus_tag="M164_0083"
FT   CDS_pept        complement(71626..72024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0083"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40719"
FT                   /db_xref="GOA:C4KJJ9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJJ9"
FT                   /protein_id="ACR40719.1"
FT   gene            72080..72949
FT                   /locus_tag="M164_0084"
FT   CDS_pept        72080..72949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0084"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40720"
FT                   /db_xref="GOA:C4KJK0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK0"
FT                   /protein_id="ACR40720.1"
FT                   NALKEIGI"
FT   gene            73011..73661
FT                   /locus_tag="M164_0085"
FT   CDS_pept        73011..73661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0085"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40721"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK1"
FT                   /protein_id="ACR40721.1"
FT   gene            73612..74397
FT                   /locus_tag="M164_0086"
FT   CDS_pept        73612..74397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0086"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40722"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK2"
FT                   /protein_id="ACR40722.1"
FT   gene            74508..75995
FT                   /locus_tag="M164_0087"
FT   CDS_pept        74508..75995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK3"
FT                   /protein_id="ACR40723.1"
FT   gene            75999..76244
FT                   /locus_tag="M164_0088"
FT   CDS_pept        75999..76244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0088"
FT                   /product="Protein of unknown function DUF131"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40724"
FT                   /db_xref="GOA:C4KJK4"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK4"
FT                   /protein_id="ACR40724.1"
FT   gene            complement(76266..77549)
FT                   /locus_tag="M164_0089"
FT   CDS_pept        complement(76266..77549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40725"
FT                   /db_xref="GOA:C4KJK5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK5"
FT                   /protein_id="ACR40725.1"
FT   sig_peptide     complement(77469..77549)
FT                   /locus_tag="M164_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.792 at
FT                   residue 27"
FT   gene            77489..78022
FT                   /locus_tag="M164_0090"
FT   CDS_pept        77489..78022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0090"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40726"
FT                   /db_xref="GOA:C4KJK6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK6"
FT                   /protein_id="ACR40726.1"
FT                   KGEKPPYSIIQISK"
FT   gene            complement(78003..79415)
FT                   /locus_tag="M164_0091"
FT   CDS_pept        complement(78003..79415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40727"
FT                   /db_xref="GOA:C4KJK7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK7"
FT                   /protein_id="ACR40727.1"
FT                   LDSKDKSTWRFE"
FT   gene            complement(79428..80318)
FT                   /locus_tag="M164_0092"
FT   CDS_pept        complement(79428..80318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0092"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40728"
FT                   /db_xref="GOA:C4KJK8"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK8"
FT                   /protein_id="ACR40728.1"
FT                   IPKARQLTSKLFRTN"
FT   gene            complement(80311..80748)
FT                   /locus_tag="M164_0093"
FT   CDS_pept        complement(80311..80748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40729"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJK9"
FT                   /protein_id="ACR40729.1"
FT   gene            80801..82126
FT                   /locus_tag="M164_0094"
FT   CDS_pept        80801..82126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0094"
FT                   /product="CoA-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40730"
FT                   /db_xref="GOA:C4KJL0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017758"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL0"
FT                   /protein_id="ACR40730.1"
FT   sig_peptide     80801..80863
FT                   /locus_tag="M164_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.712 at
FT                   residue 21"
FT   gene            82201..83319
FT                   /locus_tag="M164_0095"
FT   CDS_pept        82201..83319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40731"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL1"
FT                   /protein_id="ACR40731.1"
FT   gene            83316..85145
FT                   /locus_tag="M164_0096"
FT   CDS_pept        83316..85145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0096"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40732"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL2"
FT                   /protein_id="ACR40732.1"
FT   gene            85170..85559
FT                   /locus_tag="M164_0097"
FT   CDS_pept        85170..85559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40733"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL3"
FT                   /protein_id="ACR40733.1"
FT   gene            85537..86493
FT                   /locus_tag="M164_0098"
FT   CDS_pept        85537..86493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0098"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40734"
FT                   /db_xref="GOA:C4KJL4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL4"
FT                   /protein_id="ACR40734.1"
FT   gene            complement(86454..87542)
FT                   /locus_tag="M164_0099"
FT   CDS_pept        complement(86454..87542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40735"
FT                   /db_xref="GOA:C4KJL5"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL5"
FT                   /protein_id="ACR40735.1"
FT   gene            87596..88375
FT                   /locus_tag="M164_0100"
FT   CDS_pept        87596..88375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0100"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40736"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL6"
FT                   /protein_id="ACR40736.1"
FT   gene            88386..89129
FT                   /locus_tag="M164_0101"
FT   CDS_pept        88386..89129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0101"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40737"
FT                   /db_xref="GOA:C4KJL7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL7"
FT                   /protein_id="ACR40737.1"
FT   gene            complement(89121..90788)
FT                   /locus_tag="M164_0102"
FT   CDS_pept        complement(89121..90788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0102"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40738"
FT                   /db_xref="GOA:C4KJL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL8"
FT                   /protein_id="ACR40738.1"
FT   gene            91026..92051
FT                   /locus_tag="M164_0103"
FT   CDS_pept        91026..92051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0103"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40739"
FT                   /db_xref="GOA:C4KJL9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL9"
FT                   /protein_id="ACR40739.1"
FT                   G"
FT   gene            complement(92341..93048)
FT                   /locus_tag="M164_0104"
FT   CDS_pept        complement(92341..93048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40740"
FT                   /db_xref="UniProtKB/TrEMBL:C4KG94"
FT                   /protein_id="ACR40740.1"
FT                   DKGVIINVNISNE"
FT   gene            93160..93735
FT                   /locus_tag="M164_0105"
FT   CDS_pept        93160..93735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0105"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40741"
FT                   /db_xref="GOA:C4KJM1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM1"
FT                   /protein_id="ACR40741.1"
FT   gene            complement(93706..94095)
FT                   /locus_tag="M164_0106"
FT   CDS_pept        complement(93706..94095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0106"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40742"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM2"
FT                   /protein_id="ACR40742.1"
FT   gene            complement(94143..94547)
FT                   /locus_tag="M164_0107"
FT   CDS_pept        complement(94143..94547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0107"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40743"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM3"
FT                   /protein_id="ACR40743.1"
FT   gene            complement(94597..95280)
FT                   /locus_tag="M164_0108"
FT   CDS_pept        complement(94597..95280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0108"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40744"
FT                   /db_xref="GOA:C4KJM4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM4"
FT                   /protein_id="ACR40744.1"
FT                   IFPKS"
FT   gene            complement(95267..96256)
FT                   /locus_tag="M164_0109"
FT   CDS_pept        complement(95267..96256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0109"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40745"
FT                   /db_xref="GOA:C4KJM5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM5"
FT                   /protein_id="ACR40745.1"
FT   gene            complement(96259..97047)
FT                   /locus_tag="M164_0110"
FT   CDS_pept        complement(96259..97047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0110"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40746"
FT                   /db_xref="GOA:C4KJM6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM6"
FT                   /protein_id="ACR40746.1"
FT   gene            complement(97053..97721)
FT                   /locus_tag="M164_0111"
FT   CDS_pept        complement(97053..97721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0111"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40747"
FT                   /db_xref="GOA:C4KJM7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM7"
FT                   /protein_id="ACR40747.1"
FT                   "
FT   gene            complement(97718..98317)
FT                   /locus_tag="M164_0112"
FT   CDS_pept        complement(97718..98317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0112"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40748"
FT                   /db_xref="GOA:C4KJM8"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJM8"
FT                   /protein_id="ACR40748.1"
FT   gene            complement(98318..99367)
FT                   /locus_tag="M164_0113"
FT   CDS_pept        complement(98318..99367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0113"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40749"
FT                   /db_xref="GOA:C4KJM9"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJM9"
FT                   /protein_id="ACR40749.1"
FT                   GESLSRVGC"
FT   sig_peptide     complement(99296..99367)
FT                   /locus_tag="M164_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.980 at
FT                   residue 24"
FT   gene            complement(99364..100110)
FT                   /locus_tag="M164_0114"
FT   CDS_pept        complement(99364..100110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0114"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40750"
FT                   /db_xref="GOA:C4KJN0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN0"
FT                   /protein_id="ACR40750.1"
FT   gene            complement(100113..101111)
FT                   /locus_tag="M164_0115"
FT   CDS_pept        complement(100113..101111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0115"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40751"
FT                   /db_xref="GOA:C4KJN1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN1"
FT                   /protein_id="ACR40751.1"
FT   gene            complement(102030..103064)
FT                   /locus_tag="M164_0116"
FT   CDS_pept        complement(102030..103064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0116"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40752"
FT                   /db_xref="GOA:C4KJN2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="InterPro:IPR023863"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN2"
FT                   /protein_id="ACR40752.1"
FT                   LLSR"
FT   gene            103058..103957
FT                   /locus_tag="M164_0117"
FT   CDS_pept        103058..103957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0117"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40753"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN3"
FT                   /protein_id="ACR40753.1"
FT                   NIEYNITQKGLVFRRKVH"
FT   gene            complement(104257..105678)
FT                   /locus_tag="M164_0118"
FT   CDS_pept        complement(104257..105678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0118"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40754"
FT                   /db_xref="GOA:C4KJN4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN4"
FT                   /protein_id="ACR40754.1"
FT                   IFKELVSPSGLLQTT"
FT   gene            complement(105662..107203)
FT                   /locus_tag="M164_0119"
FT   CDS_pept        complement(105662..107203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0119"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40755"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN5"
FT                   /protein_id="ACR40755.1"
FT   gene            complement(107206..107910)
FT                   /locus_tag="M164_0120"
FT   CDS_pept        complement(107206..107910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0120"
FT                   /product="flagellar accessory protein FlaH"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40756"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK15"
FT                   /protein_id="ACR40756.1"
FT                   GVKVVPLSLSRA"
FT   gene            complement(107892..108380)
FT                   /locus_tag="M164_0121"
FT   CDS_pept        complement(107892..108380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40757"
FT                   /db_xref="GOA:C4KK16"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK16"
FT                   /protein_id="ACR40757.1"
FT   gene            complement(108383..108850)
FT                   /locus_tag="M164_0122"
FT   CDS_pept        complement(108383..108850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0122"
FT                   /product="putative flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40758"
FT                   /db_xref="GOA:C4KK17"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK17"
FT                   /protein_id="ACR40758.1"
FT   gene            complement(108843..109604)
FT                   /locus_tag="M164_0123"
FT   CDS_pept        complement(108843..109604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40759"
FT                   /db_xref="GOA:C4KK18"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK18"
FT                   /protein_id="ACR40759.1"
FT   gene            complement(109679..110599)
FT                   /locus_tag="M164_0124"
FT   CDS_pept        complement(109679..110599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0124"
FT                   /product="flagellin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40760"
FT                   /db_xref="GOA:C4KK19"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK19"
FT                   /protein_id="ACR40760.1"
FT   sig_peptide     complement(110480..110599)
FT                   /locus_tag="M164_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.937 at
FT                   residue 40"
FT   gene            110723..111208
FT                   /locus_tag="M164_0125"
FT   CDS_pept        110723..111208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40761"
FT                   /db_xref="GOA:C4KK20"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK20"
FT                   /protein_id="ACR40761.1"
FT   gene            111192..112661
FT                   /locus_tag="M164_0126"
FT   CDS_pept        111192..112661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40762"
FT                   /db_xref="GOA:C4KK21"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK21"
FT                   /protein_id="ACR40762.1"
FT   gene            112658..113101
FT                   /locus_tag="M164_0127"
FT   CDS_pept        112658..113101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40763"
FT                   /db_xref="GOA:C4KK22"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK22"
FT                   /protein_id="ACR40763.1"
FT   gene            113185..113994
FT                   /locus_tag="M164_0128"
FT   CDS_pept        113185..113994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40764"
FT                   /db_xref="GOA:C4KK23"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK23"
FT                   /protein_id="ACR40764.1"
FT   gene            114008..114493
FT                   /locus_tag="M164_0129"
FT   CDS_pept        114008..114493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40765"
FT                   /db_xref="GOA:C4KK24"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK24"
FT                   /protein_id="ACR40765.1"
FT   gene            114490..114672
FT                   /locus_tag="M164_0130"
FT   CDS_pept        114490..114672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40766"
FT                   /db_xref="GOA:C4KK25"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK25"
FT                   /protein_id="ACR40766.1"
FT                   IGVIVIAVYGAITKN"
FT   gene            114898..115122
FT                   /locus_tag="M164_0131"
FT   CDS_pept        114898..115122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0131"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40767"
FT                   /db_xref="GOA:C4KK26"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK26"
FT                   /protein_id="ACR40767.1"
FT   gene            115550..115711
FT                   /pseudo
FT                   /locus_tag="M164_0132"
FT   gene            115828..115956
FT                   /pseudo
FT                   /locus_tag="M164_0133"
FT   gene            116308..117036
FT                   /locus_tag="M164_0134"
FT   CDS_pept        116308..117036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK27"
FT                   /protein_id="ACR40768.1"
FT   gene            117297..118064
FT                   /locus_tag="M164_0135"
FT   CDS_pept        117297..118064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40769"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK28"
FT                   /protein_id="ACR40769.1"
FT   gene            complement(118059..119054)
FT                   /locus_tag="M164_0136"
FT   CDS_pept        complement(118059..119054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0136"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40770"
FT                   /db_xref="GOA:C4KK29"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK29"
FT                   /protein_id="ACR40770.1"
FT   gene            complement(119104..119469)
FT                   /locus_tag="M164_0137"
FT   CDS_pept        complement(119104..119469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40771"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK30"
FT                   /protein_id="ACR40771.1"
FT                   AYEYISFKNKAKIGIRQ"
FT   gene            119551..120162
FT                   /locus_tag="M164_0138"
FT   CDS_pept        119551..120162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40772"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK31"
FT                   /protein_id="ACR40772.1"
FT   gene            120397..121266
FT                   /locus_tag="M164_0139"
FT   CDS_pept        120397..121266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0139"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40773"
FT                   /db_xref="GOA:C4KK32"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK32"
FT                   /protein_id="ACR40773.1"
FT                   LKNIYIPI"
FT   gene            complement(120439..120518)
FT                   /pseudo
FT                   /locus_tag="M164_R0001"
FT                   /note="tRNA-OTHER2"
FT   tRNA            complement(120439..120518)
FT                   /pseudo
FT                   /locus_tag="M164_R0001"
FT                   /product="tRNA-OTHER"
FT   gene            121347..121586
FT                   /locus_tag="M164_0140"
FT   CDS_pept        121347..121586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40774"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK33"
FT                   /protein_id="ACR40774.1"
FT   gene            121596..121979
FT                   /locus_tag="M164_0141"
FT   CDS_pept        121596..121979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40775"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK34"
FT                   /protein_id="ACR40775.1"
FT   gene            121966..122262
FT                   /locus_tag="M164_0142"
FT   CDS_pept        121966..122262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40776"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK35"
FT                   /protein_id="ACR40776.1"
FT   gene            complement(122248..122421)
FT                   /locus_tag="M164_0143"
FT   CDS_pept        complement(122248..122421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40777"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK36"
FT                   /protein_id="ACR40777.1"
FT                   IILYDNNNLLTL"
FT   gene            complement(122418..126488)
FT                   /locus_tag="M164_0144"
FT   CDS_pept        complement(122418..126488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40778"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK37"
FT                   /protein_id="ACR40778.1"
FT                   REISGMAGEMIVL"
FT   gene            complement(126485..126712)
FT                   /locus_tag="M164_0145"
FT   CDS_pept        complement(126485..126712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40779"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK38"
FT                   /protein_id="ACR40779.1"
FT   gene            126751..127092
FT                   /locus_tag="M164_0146"
FT   CDS_pept        126751..127092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40780"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK39"
FT                   /protein_id="ACR40780.1"
FT                   NNDAANDDE"
FT   gene            127132..127446
FT                   /locus_tag="M164_0147"
FT   CDS_pept        127132..127446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40781"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK40"
FT                   /protein_id="ACR40781.1"
FT                   "
FT   gene            127443..127850
FT                   /locus_tag="M164_0148"
FT   CDS_pept        127443..127850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40782"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK41"
FT                   /protein_id="ACR40782.1"
FT   gene            complement(127991..128164)
FT                   /locus_tag="M164_0149"
FT   CDS_pept        complement(127991..128164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40783"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK42"
FT                   /protein_id="ACR40783.1"
FT                   EITLCYKRVKKS"
FT   gene            128219..128548
FT                   /locus_tag="M164_0150"
FT   CDS_pept        128219..128548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40784"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK43"
FT                   /protein_id="ACR40784.1"
FT                   TVREL"
FT   gene            128545..128778
FT                   /locus_tag="M164_0151"
FT   CDS_pept        128545..128778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40785"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK44"
FT                   /protein_id="ACR40785.1"
FT   gene            128800..129159
FT                   /locus_tag="M164_0152"
FT   CDS_pept        128800..129159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0152"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40786"
FT                   /db_xref="GOA:C4KK45"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK45"
FT                   /protein_id="ACR40786.1"
FT                   ALKKFAKELGVEVSS"
FT   gene            129214..129624
FT                   /locus_tag="M164_0153"
FT   CDS_pept        129214..129624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40787"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK46"
FT                   /protein_id="ACR40787.1"
FT   gene            129611..131677
FT                   /locus_tag="M164_0154"
FT   CDS_pept        129611..131677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0154"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40788"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK47"
FT                   /protein_id="ACR40788.1"
FT   gene            131661..131987
FT                   /locus_tag="M164_0155"
FT   CDS_pept        131661..131987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40789"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK48"
FT                   /protein_id="ACR40789.1"
FT                   LKSL"
FT   gene            complement(132265..132349)
FT                   /locus_tag="M164_R0002"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(132265..132349)
FT                   /locus_tag="M164_R0002"
FT                   /product="tRNA-Leu"
FT   gene            132859..133848
FT                   /locus_tag="M164_0156"
FT   CDS_pept        132859..133848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0156"
FT                   /product="transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40790"
FT                   /db_xref="GOA:C4KK49"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK49"
FT                   /protein_id="ACR40790.1"
FT   gene            133940..135013
FT                   /locus_tag="M164_0157"
FT   CDS_pept        133940..135013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0157"
FT                   /product="eRF1 domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40791"
FT                   /db_xref="GOA:C4KK50"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK50"
FT                   /protein_id="ACR40791.1"
FT                   VKKTFNGVVGKLRYRLY"
FT   gene            complement(135014..135646)
FT                   /locus_tag="M164_0158"
FT   CDS_pept        complement(135014..135646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0158"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40792"
FT                   /db_xref="GOA:C4KK51"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK51"
FT                   /protein_id="ACR40792.1"
FT   gene            135730..136542
FT                   /locus_tag="M164_0159"
FT   CDS_pept        135730..136542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0159"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40793"
FT                   /db_xref="GOA:C4KK52"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK52"
FT                   /protein_id="ACR40793.1"
FT   gene            136503..137291
FT                   /locus_tag="M164_0160"
FT   CDS_pept        136503..137291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40794"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK53"
FT                   /protein_id="ACR40794.1"
FT   gene            137307..138152
FT                   /locus_tag="M164_0161"
FT   CDS_pept        137307..138152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0161"
FT                   /product="Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40795"
FT                   /db_xref="GOA:C4KK54"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK54"
FT                   /protein_id="ACR40795.1"
FT                   "
FT   gene            138248..139075
FT                   /locus_tag="M164_0162"
FT   CDS_pept        138248..139075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0162"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40796"
FT                   /db_xref="GOA:C4KK55"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK55"
FT                   /protein_id="ACR40796.1"
FT   gene            complement(139123..139584)
FT                   /locus_tag="M164_0163"
FT   CDS_pept        complement(139123..139584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0163"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40797"
FT                   /db_xref="GOA:C4KK56"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK56"
FT                   /protein_id="ACR40797.1"
FT   gene            complement(139581..140579)
FT                   /locus_tag="M164_0164"
FT   CDS_pept        complement(139581..140579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0164"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40798"
FT                   /db_xref="GOA:C4KK57"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK57"
FT                   /protein_id="ACR40798.1"
FT   gene            complement(140587..141099)
FT                   /locus_tag="M164_0165"
FT   CDS_pept        complement(140587..141099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40799"
FT                   /db_xref="GOA:C4KK58"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK58"
FT                   /protein_id="ACR40799.1"
FT                   LFYFRKK"
FT   gene            141157..141987
FT                   /locus_tag="M164_0166"
FT   CDS_pept        141157..141987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0166"
FT                   /product="peptidase T2 asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40800"
FT                   /db_xref="GOA:C4KK59"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK59"
FT                   /protein_id="ACR40800.1"
FT   gene            141988..142527
FT                   /locus_tag="M164_0167"
FT   CDS_pept        141988..142527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40801"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK60"
FT                   /protein_id="ACR40801.1"
FT                   YVVITDSNFYIRNLRT"
FT   gene            complement(142524..142760)
FT                   /locus_tag="M164_0168"
FT   CDS_pept        complement(142524..142760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40802"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK61"
FT                   /protein_id="ACR40802.1"
FT   gene            142854..143237
FT                   /locus_tag="M164_0169"
FT   CDS_pept        142854..143237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40803"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK62"
FT                   /protein_id="ACR40803.1"
FT   gene            143277..144638
FT                   /locus_tag="M164_0170"
FT   CDS_pept        143277..144638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0170"
FT                   /product="geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40804"
FT                   /db_xref="GOA:C4KK63"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK63"
FT                   /protein_id="ACR40804.1"
FT   gene            complement(144609..146225)
FT                   /locus_tag="M164_0171"
FT   CDS_pept        complement(144609..146225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40805"
FT                   /db_xref="GOA:C4KK64"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK64"
FT                   /protein_id="ACR40805.1"
FT   gene            146256..146546
FT                   /locus_tag="M164_0172"
FT   CDS_pept        146256..146546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40806"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK65"
FT                   /protein_id="ACR40806.1"
FT   gene            146533..147327
FT                   /locus_tag="M164_0173"
FT   CDS_pept        146533..147327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0173"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40807"
FT                   /db_xref="GOA:C4KK66"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK66"
FT                   /protein_id="ACR40807.1"
FT   gene            147375..149075
FT                   /locus_tag="M164_0174"
FT   CDS_pept        147375..149075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0174"
FT                   /product="succinate dehydrogenase or fumarate
FT                   reductase,flavoprotein subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40808"
FT                   /db_xref="GOA:C4KK67"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK67"
FT                   /protein_id="ACR40808.1"
FT   gene            149077..150027
FT                   /locus_tag="M164_0175"
FT   CDS_pept        149077..150027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0175"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40809"
FT                   /db_xref="GOA:C4KK68"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK68"
FT                   /protein_id="ACR40809.1"
FT   gene            150033..150905
FT                   /locus_tag="M164_0176"
FT   CDS_pept        150033..150905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0176"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40810"
FT                   /db_xref="GOA:C4KK69"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK69"
FT                   /protein_id="ACR40810.1"
FT                   DVLRNKGVI"
FT   gene            150906..151271
FT                   /locus_tag="M164_0177"
FT   CDS_pept        150906..151271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0177"
FT                   /product="succinate dehydrogenase subunit D (SdhD)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40811"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK70"
FT                   /protein_id="ACR40811.1"
FT                   LKTFIENIRKQKQQKTS"
FT   gene            complement(151356..152714)
FT                   /locus_tag="M164_0178"
FT   CDS_pept        complement(151356..152714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0178"
FT                   /product="von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40812"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK71"
FT                   /protein_id="ACR40812.1"
FT   gene            complement(152711..153859)
FT                   /locus_tag="M164_0179"
FT   CDS_pept        complement(152711..153859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0179"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40813"
FT                   /db_xref="GOA:C4KK72"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK72"
FT                   /protein_id="ACR40813.1"
FT   gene            154294..154740
FT                   /locus_tag="M164_0180"
FT   CDS_pept        154294..154740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0180"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40814"
FT                   /db_xref="GOA:C4KK73"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK73"
FT                   /protein_id="ACR40814.1"
FT   gene            154737..155018
FT                   /locus_tag="M164_0181"
FT   CDS_pept        154737..155018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40815"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK74"
FT                   /protein_id="ACR40815.1"
FT   gene            155043..156683
FT                   /locus_tag="M164_0182"
FT   CDS_pept        155043..156683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0182"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40816"
FT                   /db_xref="GOA:C4KK75"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK75"
FT                   /protein_id="ACR40816.1"
FT   gene            157022..157957
FT                   /locus_tag="M164_0183"
FT   CDS_pept        157022..157957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0183"
FT                   /product="homoserine kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40817"
FT                   /db_xref="GOA:C4KK76"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KK76"
FT                   /protein_id="ACR40817.1"
FT   gene            157941..159071
FT                   /locus_tag="M164_0184"
FT   CDS_pept        157941..159071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0184"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40818"
FT                   /db_xref="GOA:C4KK77"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK77"
FT                   /protein_id="ACR40818.1"
FT   gene            complement(159068..159382)
FT                   /locus_tag="M164_0185"
FT   CDS_pept        complement(159068..159382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40819"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK78"
FT                   /protein_id="ACR40819.1"
FT                   "
FT   gene            complement(159361..159900)
FT                   /locus_tag="M164_0186"
FT   CDS_pept        complement(159361..159900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40820"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK79"
FT                   /protein_id="ACR40820.1"
FT                   IGIASVWDEKWTAELQ"
FT   gene            160038..161045
FT                   /locus_tag="M164_0187"
FT   CDS_pept        160038..161045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0187"
FT                   /product="protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40821"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK80"
FT                   /protein_id="ACR40821.1"
FT   gene            161076..161618
FT                   /locus_tag="M164_0188"
FT   CDS_pept        161076..161618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK81"
FT                   /protein_id="ACR40822.1"
FT                   NRYHLPIALDLVNPFSS"
FT   gene            complement(161577..162146)
FT                   /locus_tag="M164_0189"
FT   CDS_pept        complement(161577..162146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0189"
FT                   /product="KH type 1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40823"
FT                   /db_xref="GOA:C4KK82"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK82"
FT                   /protein_id="ACR40823.1"
FT   gene            complement(162143..162907)
FT                   /locus_tag="M164_0190"
FT   CDS_pept        complement(162143..162907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0190"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40824"
FT                   /db_xref="GOA:C4KK83"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK83"
FT                   /protein_id="ACR40824.1"
FT   gene            complement(162911..163237)
FT                   /locus_tag="M164_0191"
FT   CDS_pept        complement(162911..163237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0191"
FT                   /product="translation initiation factor eIF-1A"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40825"
FT                   /db_xref="GOA:C4KK84"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KK84"
FT                   /protein_id="ACR40825.1"
FT                   QLRG"
FT   gene            complement(163285..164499)
FT                   /locus_tag="M164_0192"
FT   CDS_pept        complement(163285..164499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0192"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40826"
FT                   /db_xref="GOA:C4KK85"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK85"
FT                   /protein_id="ACR40826.1"
FT                   LREMK"
FT   gene            complement(164514..165779)
FT                   /locus_tag="M164_0193"
FT   CDS_pept        complement(164514..165779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0193"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40827"
FT                   /db_xref="GOA:C4KK86"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK86"
FT                   /protein_id="ACR40827.1"
FT   gene            165824..166243
FT                   /locus_tag="M164_0194"
FT   CDS_pept        165824..166243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0194"
FT                   /product="Translation initiation factor IF2/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40828"
FT                   /db_xref="GOA:C4KK87"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KK87"
FT                   /protein_id="ACR40828.1"
FT   gene            166240..166536
FT                   /locus_tag="M164_0195"
FT   CDS_pept        166240..166536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0195"
FT                   /product="Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40829"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK88"
FT                   /protein_id="ACR40829.1"
FT   gene            166542..167255
FT                   /locus_tag="M164_0196"
FT   CDS_pept        166542..167255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0196"
FT                   /product="NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40830"
FT                   /db_xref="GOA:C4KK89"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK89"
FT                   /protein_id="ACR40830.1"
FT                   KNGKREAKLVISLRI"
FT   gene            167252..167890
FT                   /locus_tag="M164_0197"
FT   CDS_pept        167252..167890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0197"
FT                   /product="ribonuclease HII"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40831"
FT                   /db_xref="GOA:C4KK90"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK90"
FT                   /protein_id="ACR40831.1"
FT   gene            167884..168939
FT                   /locus_tag="M164_0198"
FT   CDS_pept        167884..168939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0198"
FT                   /product="TGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40832"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK91"
FT                   /protein_id="ACR40832.1"
FT                   EDKDIVEIHAK"
FT   gene            168991..170841
FT                   /locus_tag="M164_0199"
FT   CDS_pept        168991..170841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0199"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40833"
FT                   /db_xref="GOA:C4KK92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK92"
FT                   /protein_id="ACR40833.1"
FT   gene            170865..172598
FT                   /locus_tag="M164_0200"
FT   CDS_pept        170865..172598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0200"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40834"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK93"
FT                   /protein_id="ACR40834.1"
FT                   E"
FT   gene            complement(172579..173862)
FT                   /locus_tag="M164_0201"
FT   CDS_pept        complement(172579..173862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0201"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40835"
FT                   /db_xref="GOA:C4KK94"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK94"
FT                   /protein_id="ACR40835.1"
FT   gene            complement(173859..174377)
FT                   /locus_tag="M164_0202"
FT   CDS_pept        complement(173859..174377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0202"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40836"
FT                   /db_xref="GOA:C4KK95"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK95"
FT                   /protein_id="ACR40836.1"
FT                   KAIDRKKQG"
FT   gene            complement(174405..174941)
FT                   /locus_tag="M164_0203"
FT   CDS_pept        complement(174405..174941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0203"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40837"
FT                   /db_xref="GOA:C4KK96"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK96"
FT                   /protein_id="ACR40837.1"
FT                   QIRELVIKIMNSLNR"
FT   gene            complement(174959..176329)
FT                   /locus_tag="M164_0204"
FT   CDS_pept        complement(174959..176329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0204"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40838"
FT                   /db_xref="GOA:C4KK97"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK97"
FT                   /protein_id="ACR40838.1"
FT   gene            complement(176290..176985)
FT                   /locus_tag="M164_0205"
FT   CDS_pept        complement(176290..176985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0205"
FT                   /product="MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40839"
FT                   /db_xref="GOA:C4KK98"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK98"
FT                   /protein_id="ACR40839.1"
FT                   AGNTRVKKQ"
FT   gene            177023..177478
FT                   /locus_tag="M164_0206"
FT   CDS_pept        177023..177478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40840"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK99"
FT                   /protein_id="ACR40840.1"
FT   gene            complement(177469..179724)
FT                   /locus_tag="M164_0207"
FT   CDS_pept        complement(177469..179724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0207"
FT                   /product="iron-sulfur protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40841"
FT                   /db_xref="GOA:C4KKA0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA0"
FT                   /protein_id="ACR40841.1"
FT   gene            179772..180521
FT                   /locus_tag="M164_0208"
FT   CDS_pept        179772..180521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0208"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40842"
FT                   /db_xref="GOA:C4KKA1"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA1"
FT                   /protein_id="ACR40842.1"
FT   gene            180476..181276
FT                   /locus_tag="M164_0209"
FT   CDS_pept        180476..181276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0209"
FT                   /product="Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40843"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA2"
FT                   /protein_id="ACR40843.1"
FT   gene            complement(181255..182058)
FT                   /locus_tag="M164_0210"
FT   CDS_pept        complement(181255..182058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0210"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyl transferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40844"
FT                   /db_xref="GOA:C4KKA3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKA3"
FT                   /protein_id="ACR40844.1"
FT   gene            complement(181955..182689)
FT                   /locus_tag="M164_0211"
FT   CDS_pept        complement(181955..182689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40845"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA4"
FT                   /protein_id="ACR40845.1"
FT   gene            182583..183434
FT                   /locus_tag="M164_0212"
FT   CDS_pept        182583..183434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0212"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40846"
FT                   /db_xref="GOA:C4KKA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA5"
FT                   /protein_id="ACR40846.1"
FT                   DQ"
FT   gene            183434..184624
FT                   /locus_tag="M164_0213"
FT   CDS_pept        183434..184624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40847"
FT                   /db_xref="GOA:C4KKA6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA6"
FT                   /protein_id="ACR40847.1"
FT   sig_peptide     183434..183556
FT                   /locus_tag="M164_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.672 at
FT                   residue 41"
FT   gene            184657..184890
FT                   /locus_tag="M164_0214"
FT   CDS_pept        184657..184890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0214"
FT                   /product="regulatory protein AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40848"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA7"
FT                   /protein_id="ACR40848.1"
FT   gene            185154..185417
FT                   /locus_tag="M164_0215"
FT   CDS_pept        185154..185417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40849"
FT                   /db_xref="GOA:C4KKA8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA8"
FT                   /protein_id="ACR40849.1"
FT   gene            complement(185539..185856)
FT                   /locus_tag="M164_0216"
FT   CDS_pept        complement(185539..185856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA9"
FT                   /protein_id="ACR40850.1"
FT                   S"
FT   gene            186006..186182
FT                   /locus_tag="M164_0217"
FT   CDS_pept        186006..186182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0217"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40851"
FT                   /db_xref="GOA:C4KKB0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB0"
FT                   /protein_id="ACR40851.1"
FT                   ERVPVARVEKIKL"
FT   gene            complement(186179..186814)
FT                   /locus_tag="M164_0218"
FT   CDS_pept        complement(186179..186814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40852"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB1"
FT                   /protein_id="ACR40852.1"
FT   gene            complement(186823..187866)
FT                   /locus_tag="M164_0219"
FT   CDS_pept        complement(186823..187866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0219"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40853"
FT                   /db_xref="GOA:C4KKB2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB2"
FT                   /protein_id="ACR40853.1"
FT                   ALKLMNS"
FT   gene            complement(188015..188644)
FT                   /locus_tag="M164_0220"
FT   CDS_pept        complement(188015..188644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0220"
FT                   /product="protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40854"
FT                   /db_xref="GOA:C4KKB3"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB3"
FT                   /protein_id="ACR40854.1"
FT   gene            complement(188641..188841)
FT                   /locus_tag="M164_0221"
FT   CDS_pept        complement(188641..188841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40855"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB4"
FT                   /protein_id="ACR40855.1"
FT   gene            complement(188825..189217)
FT                   /locus_tag="M164_0222"
FT   CDS_pept        complement(188825..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB5"
FT                   /protein_id="ACR40856.1"
FT   gene            complement(189210..189587)
FT                   /locus_tag="M164_0223"
FT   CDS_pept        complement(189210..189587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40857"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB6"
FT                   /protein_id="ACR40857.1"
FT   gene            189620..190123
FT                   /locus_tag="M164_0224"
FT   CDS_pept        189620..190123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40858"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB7"
FT                   /protein_id="ACR40858.1"
FT                   LNES"
FT   gene            190113..190529
FT                   /locus_tag="M164_0225"
FT   CDS_pept        190113..190529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40859"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB8"
FT                   /protein_id="ACR40859.1"
FT   gene            complement(190549..190992)
FT                   /locus_tag="M164_0226"
FT   CDS_pept        complement(190549..190992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40860"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB9"
FT                   /protein_id="ACR40860.1"
FT   gene            complement(190949..192448)
FT                   /locus_tag="M164_0227"
FT   CDS_pept        complement(190949..192448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0227"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40861"
FT                   /db_xref="GOA:C4KKC0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC0"
FT                   /protein_id="ACR40861.1"
FT   gene            192541..193512
FT                   /locus_tag="M164_0228"
FT   CDS_pept        192541..193512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0228"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40862"
FT                   /db_xref="GOA:C4KKC1"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC1"
FT                   /protein_id="ACR40862.1"
FT   gene            193509..194303
FT                   /locus_tag="M164_0229"
FT   CDS_pept        193509..194303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0229"
FT                   /product="inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40863"
FT                   /db_xref="GOA:C4KKC2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC2"
FT                   /protein_id="ACR40863.1"
FT   gene            complement(194251..196071)
FT                   /locus_tag="M164_0230"
FT   CDS_pept        complement(194251..196071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0230"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40864"
FT                   /db_xref="GOA:C4KKC3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC3"
FT                   /protein_id="ACR40864.1"
FT   gene            complement(196153..197709)
FT                   /locus_tag="M164_0231"
FT   CDS_pept        complement(196153..197709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0231"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40865"
FT                   /db_xref="GOA:C4KKC4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC4"
FT                   /protein_id="ACR40865.1"
FT                   K"
FT   gene            197830..199005
FT                   /locus_tag="M164_0232"
FT   CDS_pept        197830..199005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0232"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40866"
FT                   /db_xref="GOA:C4KKC5"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC5"
FT                   /protein_id="ACR40866.1"
FT   gene            198998..199537
FT                   /locus_tag="M164_0233"
FT   CDS_pept        198998..199537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0233"
FT                   /product="phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40867"
FT                   /db_xref="GOA:C4KKC6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC6"
FT                   /protein_id="ACR40867.1"
FT                   KERFFDLYNQLLKIRK"
FT   gene            complement(199527..201188)
FT                   /locus_tag="M164_0234"
FT   CDS_pept        complement(199527..201188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0234"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40868"
FT                   /db_xref="GOA:C4KKC7"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC7"
FT                   /protein_id="ACR40868.1"
FT   gene            201268..201696
FT                   /locus_tag="M164_0235"
FT   CDS_pept        201268..201696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0235"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40869"
FT                   /db_xref="GOA:C4KKC8"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC8"
FT                   /protein_id="ACR40869.1"
FT   gene            201769..202299
FT                   /locus_tag="M164_0236"
FT   CDS_pept        201769..202299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0236"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40870"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKC9"
FT                   /protein_id="ACR40870.1"
FT                   SPSSDSGVEIKVE"
FT   gene            complement(202315..202833)
FT                   /locus_tag="M164_0237"
FT   CDS_pept        complement(202315..202833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0237"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40871"
FT                   /db_xref="GOA:C4KKD0"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD0"
FT                   /protein_id="ACR40871.1"
FT                   KPLILTNSD"
FT   gene            202902..204473
FT                   /locus_tag="M164_0238"
FT   CDS_pept        202902..204473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0238"
FT                   /product="protein synthesis factor GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40872"
FT                   /db_xref="GOA:C4KKD1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035531"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD1"
FT                   /protein_id="ACR40872.1"
FT                   VLEPIG"
FT   gene            complement(204463..204870)
FT                   /locus_tag="M164_0239"
FT   CDS_pept        complement(204463..204870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0239"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40873"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD2"
FT                   /protein_id="ACR40873.1"
FT   gene            complement(204867..205286)
FT                   /locus_tag="M164_0240"
FT   CDS_pept        complement(204867..205286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0240"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40874"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD3"
FT                   /protein_id="ACR40874.1"
FT   gene            205313..205882
FT                   /locus_tag="M164_0241"
FT   CDS_pept        205313..205882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0241"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40875"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD4"
FT                   /protein_id="ACR40875.1"
FT   gene            complement(205853..206359)
FT                   /locus_tag="M164_0242"
FT   CDS_pept        complement(205853..206359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0242"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40876"
FT                   /db_xref="GOA:C4KKD5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD5"
FT                   /protein_id="ACR40876.1"
FT                   IPKAH"
FT   gene            complement(206365..207201)
FT                   /locus_tag="M164_0243"
FT   CDS_pept        complement(206365..207201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0243"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40877"
FT                   /db_xref="GOA:C4KKD6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD6"
FT                   /protein_id="ACR40877.1"
FT   gene            complement(207431..208159)
FT                   /locus_tag="M164_0244"
FT   CDS_pept        complement(207431..208159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0244"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40878"
FT                   /db_xref="GOA:C4KKD7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD7"
FT                   /protein_id="ACR40878.1"
FT   gene            complement(208159..208746)
FT                   /locus_tag="M164_0245"
FT   CDS_pept        complement(208159..208746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40879"
FT                   /db_xref="GOA:C4KKD8"
FT                   /db_xref="InterPro:IPR009844"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD8"
FT                   /protein_id="ACR40879.1"
FT   gene            complement(208746..208985)
FT                   /locus_tag="M164_0246"
FT   CDS_pept        complement(208746..208985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40880"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKD9"
FT                   /protein_id="ACR40880.1"
FT   gene            complement(208987..209814)
FT                   /locus_tag="M164_0247"
FT   CDS_pept        complement(208987..209814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0247"
FT                   /product="sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40881"
FT                   /db_xref="GOA:C4KKE0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE0"
FT                   /protein_id="ACR40881.1"
FT   gene            209860..211011
FT                   /locus_tag="M164_0248"
FT   CDS_pept        209860..211011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0248"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40882"
FT                   /db_xref="GOA:C4KKE1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE1"
FT                   /protein_id="ACR40882.1"
FT   gene            210965..211744
FT                   /locus_tag="M164_0249"
FT   CDS_pept        210965..211744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0249"
FT                   /product="protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40883"
FT                   /db_xref="GOA:C4KKE2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE2"
FT                   /protein_id="ACR40883.1"
FT   gene            212070..213347
FT                   /locus_tag="M164_0250"
FT   CDS_pept        212070..213347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0250"
FT                   /product="glutamine synthetase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40884"
FT                   /db_xref="GOA:C4KKE3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE3"
FT                   /protein_id="ACR40884.1"
FT   gene            213348..214334
FT                   /locus_tag="M164_0251"
FT   CDS_pept        213348..214334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0251"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40885"
FT                   /db_xref="GOA:C4KKE4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE4"
FT                   /protein_id="ACR40885.1"
FT   gene            complement(214331..214570)
FT                   /locus_tag="M164_0252"
FT   CDS_pept        complement(214331..214570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0252"
FT                   /product="50S ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40886"
FT                   /db_xref="GOA:C4KKE5"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKE5"
FT                   /protein_id="ACR40886.1"
FT   gene            complement(214603..215616)
FT                   /locus_tag="M164_0253"
FT   CDS_pept        complement(214603..215616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0253"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40887"
FT                   /db_xref="GOA:C4KKE6"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKE6"
FT                   /protein_id="ACR40887.1"
FT   gene            215630..216073
FT                   /locus_tag="M164_0254"
FT   CDS_pept        215630..216073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40888"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKE7"
FT                   /protein_id="ACR40888.1"
FT   gene            complement(216050..217108)
FT                   /locus_tag="M164_0255"
FT   CDS_pept        complement(216050..217108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0255"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40889"
FT                   /db_xref="GOA:C4KKS4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS4"
FT                   /protein_id="ACR40889.1"
FT                   IEAIGLDKFFDT"
FT   gene            complement(217105..217956)
FT                   /locus_tag="M164_0256"
FT   CDS_pept        complement(217105..217956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0256"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40890"
FT                   /db_xref="GOA:C4KKS5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS5"
FT                   /protein_id="ACR40890.1"
FT                   CK"
FT   gene            218232..219590
FT                   /locus_tag="M164_0257"
FT   CDS_pept        218232..219590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0257"
FT                   /product="TIP49 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40891"
FT                   /db_xref="GOA:C4KKS6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS6"
FT                   /protein_id="ACR40891.1"
FT   gene            219674..220240
FT                   /locus_tag="M164_0258"
FT   CDS_pept        219674..220240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0258"
FT                   /product="GMP synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40892"
FT                   /db_xref="GOA:C4KKS7"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS7"
FT                   /protein_id="ACR40892.1"
FT   gene            complement(220243..221031)
FT                   /locus_tag="M164_0259"
FT   CDS_pept        complement(220243..221031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0259"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40893"
FT                   /db_xref="GOA:C4KKS8"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS8"
FT                   /protein_id="ACR40893.1"
FT   gene            221110..221595
FT                   /locus_tag="M164_0260"
FT   CDS_pept        221110..221595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0260"
FT                   /product="dual specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40894"
FT                   /db_xref="GOA:C4KKS9"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKS9"
FT                   /protein_id="ACR40894.1"
FT   gene            221565..222161
FT                   /locus_tag="M164_0261"
FT   CDS_pept        221565..222161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0261"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40895"
FT                   /db_xref="GOA:C4KKT0"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKT0"
FT                   /protein_id="ACR40895.1"
FT   gene            222166..222783
FT                   /locus_tag="M164_0262"
FT   CDS_pept        222166..222783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0262"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40896"
FT                   /db_xref="GOA:C4KKT1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT1"
FT                   /protein_id="ACR40896.1"
FT   gene            222792..223781
FT                   /locus_tag="M164_0263"
FT   CDS_pept        222792..223781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0263"
FT                   /product="phosphoesterase DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40897"
FT                   /db_xref="GOA:C4KKT2"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT2"
FT                   /protein_id="ACR40897.1"
FT   gene            complement(223778..224464)
FT                   /locus_tag="M164_0264"
FT   CDS_pept        complement(223778..224464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0264"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40898"
FT                   /db_xref="GOA:C4KKT3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT3"
FT                   /protein_id="ACR40898.1"
FT                   ITIHTL"
FT   gene            224496..225635
FT                   /locus_tag="M164_0265"
FT   CDS_pept        224496..225635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0265"
FT                   /product="protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40899"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT4"
FT                   /protein_id="ACR40899.1"
FT   gene            225745..226407
FT                   /locus_tag="M164_0266"
FT   CDS_pept        225745..226407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0266"
FT                   /product="protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40900"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT5"
FT                   /protein_id="ACR40900.1"
FT   gene            complement(226396..227382)
FT                   /locus_tag="M164_0267"
FT   CDS_pept        complement(226396..227382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0267"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40901"
FT                   /db_xref="GOA:C4KKT6"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT6"
FT                   /protein_id="ACR40901.1"
FT   gene            complement(227342..227611)
FT                   /locus_tag="M164_0268"
FT   CDS_pept        complement(227342..227611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0268"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40902"
FT                   /db_xref="GOA:C4KKT7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT7"
FT                   /protein_id="ACR40902.1"
FT   gene            227740..229887
FT                   /locus_tag="M164_0269"
FT   CDS_pept        227740..229887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0269"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40903"
FT                   /db_xref="GOA:C4KKT8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT8"
FT                   /protein_id="ACR40903.1"
FT   gene            complement(230024..231595)
FT                   /locus_tag="M164_0270"
FT   CDS_pept        complement(230024..231595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0270"
FT                   /product="carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40904"
FT                   /db_xref="GOA:C4KKT9"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKT9"
FT                   /protein_id="ACR40904.1"
FT                   HGNIPL"
FT   gene            complement(231620..232129)
FT                   /locus_tag="M164_0271"
FT   CDS_pept        complement(231620..232129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0271"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40905"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU0"
FT                   /protein_id="ACR40905.1"
FT                   ILIVIK"
FT   gene            complement(232129..233661)
FT                   /locus_tag="M164_0272"
FT   CDS_pept        complement(232129..233661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0272"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40906"
FT                   /db_xref="GOA:C4KKU1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU1"
FT                   /protein_id="ACR40906.1"
FT   gene            complement(234086..235693)
FT                   /locus_tag="M164_0273"
FT   CDS_pept        complement(234086..235693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0273"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40907"
FT                   /db_xref="GOA:C4KKU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU2"
FT                   /protein_id="ACR40907.1"
FT                   MMDLAREKYVAEEGIYLA"
FT   gene            complement(235686..236384)
FT                   /locus_tag="M164_0274"
FT   CDS_pept        complement(235686..236384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0274"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40908"
FT                   /db_xref="GOA:C4KKU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU3"
FT                   /protein_id="ACR40908.1"
FT                   PVKKGGNNNE"
FT   gene            complement(236526..236765)
FT                   /locus_tag="M164_0275"
FT   CDS_pept        complement(236526..236765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40909"
FT                   /db_xref="GOA:C4KKU4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU4"
FT                   /protein_id="ACR40909.1"
FT   gene            complement(236799..237296)
FT                   /locus_tag="M164_0276"
FT   CDS_pept        complement(236799..237296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0276"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40910"
FT                   /db_xref="GOA:C4KKU5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKU5"
FT                   /protein_id="ACR40910.1"
FT                   RN"
FT   gene            complement(237297..238544)
FT                   /locus_tag="M164_0277"
FT   CDS_pept        complement(237297..238544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0277"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40911"
FT                   /db_xref="GOA:C4KKU6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU6"
FT                   /protein_id="ACR40911.1"
FT                   AAISALEGKITDPRVI"
FT   gene            complement(238628..239929)
FT                   /locus_tag="M164_0278"
FT   CDS_pept        complement(238628..239929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0278"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40912"
FT                   /db_xref="GOA:C4KKU7"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU7"
FT                   /protein_id="ACR40912.1"
FT   gene            240010..241848
FT                   /locus_tag="M164_0279"
FT   CDS_pept        240010..241848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0279"
FT                   /product="glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40913"
FT                   /db_xref="GOA:C4KKU8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU8"
FT                   /protein_id="ACR40913.1"
FT   gene            241939..242334
FT                   /locus_tag="M164_0280"
FT   CDS_pept        241939..242334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0280"
FT                   /product="transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40914"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKU9"
FT                   /protein_id="ACR40914.1"
FT   gene            complement(242352..242639)
FT                   /locus_tag="M164_0281"
FT   CDS_pept        complement(242352..242639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40915"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV0"
FT                   /protein_id="ACR40915.1"
FT   gene            242787..243521
FT                   /locus_tag="M164_0282"
FT   CDS_pept        242787..243521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40916"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV1"
FT                   /protein_id="ACR40916.1"
FT   gene            243648..243842
FT                   /locus_tag="M164_0283"
FT   CDS_pept        243648..243842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0283"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40917"
FT                   /db_xref="GOA:C4KKV2"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV2"
FT                   /protein_id="ACR40917.1"
FT   sig_peptide     243648..243716
FT                   /locus_tag="M164_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.462 at
FT                   residue 23"
FT   gene            243848..245365
FT                   /locus_tag="M164_0284"
FT   CDS_pept        243848..245365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0284"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40918"
FT                   /db_xref="GOA:C4KKV3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV3"
FT                   /protein_id="ACR40918.1"
FT   gene            245429..246172
FT                   /locus_tag="M164_0285"
FT   CDS_pept        245429..246172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0285"
FT                   /product="Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40919"
FT                   /db_xref="GOA:C4KKV4"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV4"
FT                   /protein_id="ACR40919.1"
FT   gene            246207..246407
FT                   /locus_tag="M164_0286"
FT   CDS_pept        246207..246407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40920"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV5"
FT                   /protein_id="ACR40920.1"
FT   gene            complement(246428..247141)
FT                   /locus_tag="M164_0287"
FT   CDS_pept        complement(246428..247141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0287"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40921"
FT                   /db_xref="GOA:C4KKV6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV6"
FT                   /protein_id="ACR40921.1"
FT                   SEDLIKMKNGLSSER"
FT   gene            247415..247531
FT                   /locus_tag="M164_0288"
FT   CDS_pept        247415..247531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKV7"
FT                   /protein_id="ACR40922.1"
FT   gene            complement(247637..248092)
FT                   /locus_tag="M164_0289"
FT   CDS_pept        complement(247637..248092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0289"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40923"
FT                   /db_xref="GOA:C4KKV8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKV8"
FT                   /protein_id="ACR40923.1"
FT   gene            complement(248130..249767)
FT                   /locus_tag="M164_0290"
FT   CDS_pept        complement(248130..249767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0290"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40924"
FT                   /db_xref="GOA:C4KKV9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KKV9"
FT                   /protein_id="ACR40924.1"
FT   gene            249819..250775
FT                   /locus_tag="M164_0291"
FT   CDS_pept        249819..250775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0291"
FT                   /product="Oligosaccharide biosynthesis protein Alg14 like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40925"
FT                   /db_xref="GOA:C4KKW0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW0"
FT                   /protein_id="ACR40925.1"
FT   sig_peptide     249819..249878
FT                   /locus_tag="M164_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.640 at
FT                   residue 20"
FT   gene            250775..251458
FT                   /locus_tag="M164_0292"
FT   CDS_pept        250775..251458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0292"
FT                   /product="HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40926"
FT                   /db_xref="GOA:C4KKW1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW1"
FT                   /protein_id="ACR40926.1"
FT                   RENSS"
FT   gene            251543..252556
FT                   /locus_tag="M164_0293"
FT   CDS_pept        251543..252556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0293"
FT                   /product="Succinate--CoA ligase (ADP-forming)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40927"
FT                   /db_xref="GOA:C4KKW2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW2"
FT                   /protein_id="ACR40927.1"
FT   gene            252622..253404
FT                   /locus_tag="M164_0294"
FT   CDS_pept        252622..253404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0294"
FT                   /product="ATP-citrate lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40928"
FT                   /db_xref="GOA:C4KKW3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW3"
FT                   /protein_id="ACR40928.1"
FT   gene            complement(253390..254439)
FT                   /locus_tag="M164_0295"
FT   CDS_pept        complement(253390..254439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40929"
FT                   /db_xref="GOA:C4KKW4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW4"
FT                   /protein_id="ACR40929.1"
FT                   TATYMLRKK"
FT   sig_peptide     complement(254371..254439)
FT                   /locus_tag="M164_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.648 at
FT                   residue 23"
FT   gene            254670..255032
FT                   /locus_tag="M164_0296"
FT   CDS_pept        254670..255032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40930"
FT                   /db_xref="GOA:C4KKW5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW5"
FT                   /protein_id="ACR40930.1"
FT                   TFIIHRGKILGFTDQI"
FT   gene            complement(255016..255216)
FT                   /locus_tag="M164_0297"
FT   CDS_pept        complement(255016..255216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40931"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW6"
FT                   /protein_id="ACR40931.1"
FT   gene            255774..256523
FT                   /locus_tag="M164_0298"
FT   CDS_pept        255774..256523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0298"
FT                   /product="sulfocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40932"
FT                   /db_xref="GOA:C4KKW7"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010532"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034246"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW7"
FT                   /protein_id="ACR40932.1"
FT   sig_peptide     255774..255839
FT                   /locus_tag="M164_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.813 at
FT                   residue 22"
FT   gene            256563..257327
FT                   /locus_tag="M164_0299"
FT   CDS_pept        256563..257327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40933"
FT                   /db_xref="GOA:C4KKW8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW8"
FT                   /protein_id="ACR40933.1"
FT   gene            257371..258354
FT                   /locus_tag="M164_0300"
FT   CDS_pept        257371..258354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0300"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40934"
FT                   /db_xref="GOA:C4KKW9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKW9"
FT                   /protein_id="ACR40934.1"
FT   gene            258356..258799
FT                   /locus_tag="M164_0301"
FT   CDS_pept        258356..258799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40935"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX0"
FT                   /protein_id="ACR40935.1"
FT   gene            258825..259556
FT                   /locus_tag="M164_0302"
FT   CDS_pept        258825..259556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40936"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX1"
FT                   /protein_id="ACR40936.1"
FT   gene            259671..260588
FT                   /locus_tag="M164_0303"
FT   CDS_pept        259671..260588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0303"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40937"
FT                   /db_xref="GOA:C4KKX2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX2"
FT                   /protein_id="ACR40937.1"
FT   gene            260665..261675
FT                   /locus_tag="M164_0304"
FT   CDS_pept        260665..261675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40938"
FT                   /db_xref="GOA:C4KKX3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX3"
FT                   /protein_id="ACR40938.1"
FT   gene            complement(261661..262848)
FT                   /locus_tag="M164_0305"
FT   CDS_pept        complement(261661..262848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0305"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40939"
FT                   /db_xref="GOA:C4KKX4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX4"
FT                   /protein_id="ACR40939.1"
FT   gene            complement(262885..263784)
FT                   /locus_tag="M164_0306"
FT   CDS_pept        complement(262885..263784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0306"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40940"
FT                   /db_xref="GOA:C4KKX5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX5"
FT                   /protein_id="ACR40940.1"
FT                   LSKLYNSKVNISEFLQPI"
FT   gene            complement(263789..264715)
FT                   /locus_tag="M164_0307"
FT   CDS_pept        complement(263789..264715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0307"
FT                   /product="ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40941"
FT                   /db_xref="GOA:C4KKX6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX6"
FT                   /protein_id="ACR40941.1"
FT   gene            complement(264805..265563)
FT                   /locus_tag="M164_0308"
FT   CDS_pept        complement(264805..265563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0308"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40942"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX7"
FT                   /protein_id="ACR40942.1"
FT   gene            complement(265598..266644)
FT                   /locus_tag="M164_0309"
FT   CDS_pept        complement(265598..266644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0309"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40943"
FT                   /db_xref="GOA:C4KKX8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX8"
FT                   /protein_id="ACR40943.1"
FT                   IRAIIRWN"
FT   gene            complement(266927..267331)
FT                   /locus_tag="M164_0310"
FT   CDS_pept        complement(266927..267331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40944"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKX9"
FT                   /protein_id="ACR40944.1"
FT   gene            complement(267395..268786)
FT                   /locus_tag="M164_0311"
FT   CDS_pept        complement(267395..268786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0311"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40945"
FT                   /db_xref="GOA:C4KKY0"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY0"
FT                   /protein_id="ACR40945.1"
FT                   KRVLS"
FT   gene            complement(269196..269333)
FT                   /locus_tag="M164_2782"
FT   CDS_pept        complement(269196..269333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2782"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40946"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY1"
FT                   /protein_id="ACR40946.1"
FT                   "
FT   gene            complement(269581..271068)
FT                   /locus_tag="M164_0312"
FT   CDS_pept        complement(269581..271068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0312"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40947"
FT                   /db_xref="GOA:C4KKY2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY2"
FT                   /protein_id="ACR40947.1"
FT   gene            271308..271913
FT                   /locus_tag="M164_0313"
FT   CDS_pept        271308..271913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0313"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40948"
FT                   /db_xref="GOA:C4KKY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY3"
FT                   /protein_id="ACR40948.1"
FT   gene            complement(271910..272353)
FT                   /locus_tag="M164_0314"
FT   CDS_pept        complement(271910..272353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40949"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY4"
FT                   /protein_id="ACR40949.1"
FT   gene            272444..273586
FT                   /locus_tag="M164_0315"
FT   CDS_pept        272444..273586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0315"
FT                   /product="acetyl-CoA C-acetyltransferase
FT                   (acetoacetyl-CoAthiolase) (AcaB-6)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40950"
FT                   /db_xref="GOA:C4KKY5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY5"
FT                   /protein_id="ACR40950.1"
FT   gene            273583..273939
FT                   /locus_tag="M164_0316"
FT   CDS_pept        273583..273939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0316"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40951"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY6"
FT                   /protein_id="ACR40951.1"
FT                   KEINGKKYPLFKVI"
FT   gene            274007..275677
FT                   /locus_tag="M164_0317"
FT   CDS_pept        274007..275677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0317"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40952"
FT                   /db_xref="GOA:C4KKY7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY7"
FT                   /protein_id="ACR40952.1"
FT   gene            275701..276813
FT                   /locus_tag="M164_0318"
FT   CDS_pept        275701..276813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0318"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40953"
FT                   /db_xref="GOA:C4KKY8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY8"
FT                   /protein_id="ACR40953.1"
FT   gene            complement(276840..278831)
FT                   /locus_tag="M164_0319"
FT   CDS_pept        complement(276840..278831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0319"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40954"
FT                   /db_xref="GOA:C4KKY9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKY9"
FT                   /protein_id="ACR40954.1"
FT   gene            complement(278913..279845)
FT                   /locus_tag="M164_0320"
FT   CDS_pept        complement(278913..279845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0320"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40955"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ0"
FT                   /protein_id="ACR40955.1"
FT   gene            280054..281520
FT                   /locus_tag="M164_0321"
FT   CDS_pept        280054..281520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0321"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40956"
FT                   /db_xref="GOA:C4KKZ1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ1"
FT                   /protein_id="ACR40956.1"
FT   gene            281902..282132
FT                   /locus_tag="M164_0322"
FT   CDS_pept        281902..282132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0322"
FT                   /product="carboxylesterase (est)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40957"
FT                   /db_xref="GOA:C4KKZ2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ2"
FT                   /protein_id="ACR40957.1"
FT   gene            282339..282503
FT                   /pseudo
FT                   /locus_tag="M164_0323"
FT   gene            282490..283573
FT                   /pseudo
FT                   /locus_tag="M164_0324"
FT                   /note="transposase"
FT   gene            283616..284062
FT                   /locus_tag="M164_0326"
FT   CDS_pept        283616..284062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0326"
FT                   /product="carboxylesterase (est)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40958"
FT                   /db_xref="GOA:C4KKZ3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ3"
FT                   /protein_id="ACR40958.1"
FT   gene            284144..284560
FT                   /locus_tag="M164_0327"
FT   CDS_pept        284144..284560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40959"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ4"
FT                   /protein_id="ACR40959.1"
FT   gene            284538..284693
FT                   /locus_tag="M164_0328"
FT   CDS_pept        284538..284693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40960"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ5"
FT                   /protein_id="ACR40960.1"
FT                   MIEMKV"
FT   gene            complement(284763..285683)
FT                   /locus_tag="M164_0329"
FT   CDS_pept        complement(284763..285683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0329"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40961"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ6"
FT                   /protein_id="ACR40961.1"
FT   gene            285727..286680
FT                   /locus_tag="M164_0330"
FT   CDS_pept        285727..286680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0330"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40962"
FT                   /db_xref="GOA:C4KKZ7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ7"
FT                   /protein_id="ACR40962.1"
FT   gene            complement(286674..287603)
FT                   /locus_tag="M164_0331"
FT   CDS_pept        complement(286674..287603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0331"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40963"
FT                   /db_xref="GOA:C4KKZ8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ8"
FT                   /protein_id="ACR40963.1"
FT   gene            complement(287637..288581)
FT                   /locus_tag="M164_0332"
FT   CDS_pept        complement(287637..288581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0332"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40964"
FT                   /db_xref="GOA:C4KKZ9"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:4G2D"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKZ9"
FT                   /protein_id="ACR40964.1"
FT   gene            288661..290343
FT                   /locus_tag="M164_0333"
FT   CDS_pept        288661..290343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0333"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40965"
FT                   /db_xref="GOA:C4KL00"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL00"
FT                   /protein_id="ACR40965.1"
FT   gene            complement(290400..290843)
FT                   /locus_tag="M164_0334"
FT   CDS_pept        complement(290400..290843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0334"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40966"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL01"
FT                   /protein_id="ACR40966.1"
FT   gene            complement(290847..292145)
FT                   /locus_tag="M164_0335"
FT   CDS_pept        complement(290847..292145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0335"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40967"
FT                   /db_xref="GOA:C4KL02"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL02"
FT                   /protein_id="ACR40967.1"
FT   gene            292328..292924
FT                   /locus_tag="M164_0336"
FT   CDS_pept        292328..292924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0336"
FT                   /product="carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40968"
FT                   /db_xref="GOA:C4KL03"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL03"
FT                   /protein_id="ACR40968.1"
FT   gene            complement(292895..293170)
FT                   /locus_tag="M164_0337"
FT   CDS_pept        complement(292895..293170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0337"
FT                   /product="sugar transport related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40969"
FT                   /db_xref="GOA:C4KL04"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL04"
FT                   /protein_id="ACR40969.1"
FT   gene            complement(293215..293526)
FT                   /locus_tag="M164_0338"
FT   CDS_pept        complement(293215..293526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40970"
FT                   /db_xref="GOA:C4KL05"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL05"
FT                   /protein_id="ACR40970.1"
FT   gene            293505..293855
FT                   /locus_tag="M164_0339"
FT   CDS_pept        293505..293855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40971"
FT                   /db_xref="GOA:C4KL06"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL06"
FT                   /protein_id="ACR40971.1"
FT                   ITVTANDIAFKS"
FT   gene            complement(293986..294858)
FT                   /locus_tag="M164_0340"
FT   CDS_pept        complement(293986..294858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0340"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40972"
FT                   /db_xref="GOA:C4KL07"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL07"
FT                   /protein_id="ACR40972.1"
FT                   VLSWKYLSK"
FT   gene            complement(294855..295853)
FT                   /locus_tag="M164_0341"
FT   CDS_pept        complement(294855..295853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0341"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40973"
FT                   /db_xref="GOA:C4KL08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL08"
FT                   /protein_id="ACR40973.1"
FT   gene            complement(295846..296253)
FT                   /locus_tag="M164_0342"
FT   CDS_pept        complement(295846..296253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0342"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40974"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL09"
FT                   /protein_id="ACR40974.1"
FT   gene            296655..296882
FT                   /locus_tag="M164_0343"
FT   CDS_pept        296655..296882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL10"
FT                   /protein_id="ACR40975.1"
FT   gene            complement(296934..297137)
FT                   /locus_tag="M164_0344"
FT   CDS_pept        complement(296934..297137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0344"
FT                   /product="transposase ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40976"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL11"
FT                   /protein_id="ACR40976.1"
FT   gene            complement(297861..298355)
FT                   /locus_tag="M164_0345"
FT   CDS_pept        complement(297861..298355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0345"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40977"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL12"
FT                   /protein_id="ACR40977.1"
FT                   L"
FT   gene            298885..299058
FT                   /locus_tag="M164_0346"
FT   CDS_pept        298885..299058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0346"
FT                   /product="partial transposase in ISC1190"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40978"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL13"
FT                   /protein_id="ACR40978.1"
FT                   LMGEYDVRIINP"
FT   gene            complement(299075..299589)
FT                   /pseudo
FT                   /locus_tag="M164_0347"
FT   gene            complement(299552..300034)
FT                   /locus_tag="M164_0348"
FT   CDS_pept        complement(299552..300034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0348"
FT                   /product="ORF1 in transposon ISC1048"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40979"
FT                   /db_xref="GOA:C4KL14"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL14"
FT                   /protein_id="ACR40979.1"
FT   gene            complement(300052..300686)
FT                   /pseudo
FT                   /locus_tag="M164_0349"
FT   gene            complement(300992..301252)
FT                   /locus_tag="M164_0350"
FT   CDS_pept        complement(300992..301252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0350"
FT                   /product="transposase ISC1225"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40980"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL15"
FT                   /protein_id="ACR40980.1"
FT   gene            complement(301548..301919)
FT                   /locus_tag="M164_0351"
FT   CDS_pept        complement(301548..301919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0351"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40981"
FT                   /db_xref="GOA:C4KL16"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL16"
FT                   /protein_id="ACR40981.1"
FT   gene            complement(301900..302292)
FT                   /locus_tag="M164_0352"
FT   CDS_pept        complement(301900..302292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0352"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40982"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL17"
FT                   /protein_id="ACR40982.1"
FT   gene            302951..303109
FT                   /locus_tag="M164_0353"
FT   CDS_pept        302951..303109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40983"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL18"
FT                   /protein_id="ACR40983.1"
FT                   IDRLFYQ"
FT   gene            303420..303680
FT                   /locus_tag="M164_0354"
FT   CDS_pept        303420..303680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40984"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL19"
FT                   /protein_id="ACR40984.1"
FT   gene            complement(303657..304058)
FT                   /locus_tag="M164_0355"
FT   CDS_pept        complement(303657..304058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0355"
FT                   /product="conserved hypothetical selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40985"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL20"
FT                   /protein_id="ACR40985.1"
FT   gene            304403..305626
FT                   /locus_tag="M164_0356"
FT   CDS_pept        304403..305626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0356"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40986"
FT                   /db_xref="GOA:C4KL21"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL21"
FT                   /protein_id="ACR40986.1"
FT                   FDLKELLK"
FT   gene            complement(305875..306189)
FT                   /locus_tag="M164_0357"
FT   CDS_pept        complement(305875..306189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0357"
FT                   /product="methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40987"
FT                   /db_xref="GOA:C4KL22"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL22"
FT                   /protein_id="ACR40987.1"
FT                   "
FT   gene            306306..307271
FT                   /locus_tag="M164_0358"
FT   CDS_pept        306306..307271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0358"
FT                   /product="cellulase (endo 1,4 beta glucanase), putative
FT                   (CelB)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40988"
FT                   /db_xref="GOA:C4KL23"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL23"
FT                   /protein_id="ACR40988.1"
FT   gene            complement(307260..307673)
FT                   /locus_tag="M164_0359"
FT   CDS_pept        complement(307260..307673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0359"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40989"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL24"
FT                   /protein_id="ACR40989.1"
FT   gene            307715..307852
FT                   /locus_tag="M164_0360"
FT   CDS_pept        307715..307852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40990"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL25"
FT                   /protein_id="ACR40990.1"
FT                   "
FT   gene            308343..309137
FT                   /locus_tag="M164_0361"
FT   CDS_pept        308343..309137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0361"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40991"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL26"
FT                   /protein_id="ACR40991.1"
FT   gene            309352..309711
FT                   /locus_tag="M164_0362"
FT   CDS_pept        309352..309711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40992"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL27"
FT                   /protein_id="ACR40992.1"
FT                   LSNGQTLNISVVYQP"
FT   gene            309949..310413
FT                   /locus_tag="M164_0363"
FT   CDS_pept        309949..310413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0363"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40993"
FT                   /db_xref="GOA:C4KL28"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL28"
FT                   /protein_id="ACR40993.1"
FT   gene            complement(310467..311483)
FT                   /locus_tag="M164_0364"
FT   CDS_pept        complement(310467..311483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0364"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40994"
FT                   /db_xref="GOA:C4KL29"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL29"
FT                   /protein_id="ACR40994.1"
FT   gene            complement(311502..312749)
FT                   /locus_tag="M164_0365"
FT   CDS_pept        complement(311502..312749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0365"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40995"
FT                   /db_xref="GOA:C4KL30"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL30"
FT                   /protein_id="ACR40995.1"
FT                   PITKPVYWVGVRGDPW"
FT   gene            complement(312746..313837)
FT                   /locus_tag="M164_2843"
FT   CDS_pept        complement(312746..313837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2843"
FT                   /product="pyruvate ferredoxin, flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2843"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40996"
FT                   /db_xref="GOA:C4KL31"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL31"
FT                   /protein_id="ACR40996.1"
FT   gene            complement(314047..315339)
FT                   /locus_tag="M164_0367"
FT   CDS_pept        complement(314047..315339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0367"
FT                   /product="Oxalate/Formate Antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40997"
FT                   /db_xref="GOA:C4KL32"
FT                   /db_xref="InterPro:IPR004741"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL32"
FT                   /protein_id="ACR40997.1"
FT   sig_peptide     complement(315238..315339)
FT                   /locus_tag="M164_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.484 at
FT                   residue 34"
FT   gene            complement(315747..317339)
FT                   /locus_tag="M164_0368"
FT   CDS_pept        complement(315747..317339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0368"
FT                   /product="L-lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40998"
FT                   /db_xref="GOA:C4KL33"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL33"
FT                   /protein_id="ACR40998.1"
FT                   VLYAFLAPSLFVH"
FT   gene            complement(317841..318194)
FT                   /locus_tag="M164_0369"
FT   CDS_pept        complement(317841..318194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0369"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40999"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL34"
FT                   /protein_id="ACR40999.1"
FT                   LSLSGYIEIKLIQ"
FT   gene            complement(318191..318418)
FT                   /locus_tag="M164_0370"
FT   CDS_pept        complement(318191..318418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41000"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL35"
FT                   /protein_id="ACR41000.1"
FT   gene            complement(318844..319590)
FT                   /locus_tag="M164_0371"
FT   CDS_pept        complement(318844..319590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0371"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41001"
FT                   /db_xref="GOA:C4KL36"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL36"
FT                   /protein_id="ACR41001.1"
FT   gene            319742..320221
FT                   /locus_tag="M164_0372"
FT   CDS_pept        319742..320221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41002"
FT                   /db_xref="GOA:C4KL37"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL37"
FT                   /protein_id="ACR41002.1"
FT   gene            320214..320618
FT                   /locus_tag="M164_0373"
FT   CDS_pept        320214..320618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41003"
FT                   /db_xref="GOA:C4KL38"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL38"
FT                   /protein_id="ACR41003.1"
FT   gene            320861..322375
FT                   /locus_tag="M164_0374"
FT   CDS_pept        320861..322375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0374"
FT                   /product="Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41004"
FT                   /db_xref="GOA:C4KL39"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL39"
FT                   /protein_id="ACR41004.1"
FT   gene            complement(322397..323044)
FT                   /locus_tag="M164_0375"
FT   CDS_pept        complement(322397..323044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0375"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41005"
FT                   /db_xref="GOA:C4KL40"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL40"
FT                   /protein_id="ACR41005.1"
FT   gene            323329..323694
FT                   /locus_tag="M164_0376"
FT   CDS_pept        323329..323694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0376"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41006"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL41"
FT                   /protein_id="ACR41006.1"
FT                   LEITQPTHGERHGEHYH"
FT   gene            complement(323691..323861)
FT                   /locus_tag="M164_0377"
FT   CDS_pept        complement(323691..323861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41007"
FT                   /db_xref="GOA:C4KL42"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL42"
FT                   /protein_id="ACR41007.1"
FT                   YFTNIEESRQL"
FT   gene            complement(323800..324270)
FT                   /locus_tag="M164_0378"
FT   CDS_pept        complement(323800..324270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41008"
FT                   /db_xref="GOA:C4KL43"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL43"
FT                   /protein_id="ACR41008.1"
FT   gene            complement(324239..324406)
FT                   /locus_tag="M164_0379"
FT   CDS_pept        complement(324239..324406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41009"
FT                   /db_xref="GOA:C4KL44"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL44"
FT                   /protein_id="ACR41009.1"
FT                   FVKLELYHIC"
FT   gene            324526..324729
FT                   /pseudo
FT                   /locus_tag="M164_0380"
FT   gene            324869..325060
FT                   /locus_tag="M164_0381"
FT   CDS_pept        324869..325060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0381"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41010"
FT                   /db_xref="GOA:C4KL45"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL45"
FT                   /protein_id="ACR41010.1"
FT                   LMPIGALVFYAVVMIIRD"
FT   gene            325065..326645
FT                   /locus_tag="M164_0382"
FT   CDS_pept        325065..326645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0382"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41011"
FT                   /db_xref="GOA:C4KL46"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL46"
FT                   /protein_id="ACR41011.1"
FT                   SNIRAEEIG"
FT   gene            complement(326686..327495)
FT                   /locus_tag="M164_0383"
FT   CDS_pept        complement(326686..327495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0383"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41012"
FT                   /db_xref="GOA:C4KL47"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL47"
FT                   /protein_id="ACR41012.1"
FT   gene            complement(327621..328592)
FT                   /locus_tag="M164_0384"
FT   CDS_pept        complement(327621..328592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0384"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41013"
FT                   /db_xref="GOA:C4KL48"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL48"
FT                   /protein_id="ACR41013.1"
FT   gene            complement(328641..329450)
FT                   /locus_tag="M164_0385"
FT   CDS_pept        complement(328641..329450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41014"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL49"
FT                   /protein_id="ACR41014.1"
FT   gene            complement(329545..329640)
FT                   /locus_tag="M164_2783"
FT   CDS_pept        complement(329545..329640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2783"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2783"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41015"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL50"
FT                   /protein_id="ACR41015.1"
FT                   /translation="MIFEEEEDLWEEEEDWDEEEEDLWEEEEEEW"
FT   gene            330690..331979
FT                   /locus_tag="M164_0386"
FT   CDS_pept        330690..331979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0386"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41016"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL51"
FT                   /protein_id="ACR41016.1"
FT   gene            331982..332497
FT                   /locus_tag="M164_0387"
FT   CDS_pept        331982..332497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0387"
FT                   /product="protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41017"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL52"
FT                   /protein_id="ACR41017.1"
FT                   VKNNLNYK"
FT   gene            complement(332509..333318)
FT                   /locus_tag="M164_0388"
FT   CDS_pept        complement(332509..333318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0388"
FT                   /product="amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41018"
FT                   /db_xref="GOA:C4KL53"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL53"
FT                   /protein_id="ACR41018.1"
FT   gene            complement(333346..333981)
FT                   /locus_tag="M164_0389"
FT   CDS_pept        complement(333346..333981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41019"
FT                   /db_xref="UniProtKB/TrEMBL:C4KL54"
FT                   /protein_id="ACR41019.1"
FT   gene            complement(333962..334579)
FT                   /locus_tag="M164_0390"
FT   CDS_pept        complement(333962..334579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0390"
FT                   /product="thymidylate kinase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41020"
FT                   /db_xref="GOA:C4KDP7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP7"
FT                   /protein_id="ACR41020.1"
FT   gene            complement(334563..335204)
FT                   /locus_tag="M164_0391"
FT   CDS_pept        complement(334563..335204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0391"
FT                   /product="dTMP kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41021"
FT                   /db_xref="GOA:C4KDP8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP8"
FT                   /protein_id="ACR41021.1"
FT   gene            complement(335201..336457)
FT                   /locus_tag="M164_0392"
FT   CDS_pept        complement(335201..336457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0392"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41022"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDP9"
FT                   /protein_id="ACR41022.1"
FT   gene            complement(336458..336943)
FT                   /locus_tag="M164_0393"
FT   CDS_pept        complement(336458..336943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0393"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41023"
FT                   /db_xref="GOA:C4KDQ0"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ0"
FT                   /protein_id="ACR41023.1"
FT   gene            337454..337588
FT                   /locus_tag="M164_0394"
FT   CDS_pept        337454..337588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41024"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ1"
FT                   /protein_id="ACR41024.1"
FT   gene            337585..337776
FT                   /locus_tag="M164_2833"
FT   CDS_pept        337585..337776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2833"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41025"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ2"
FT                   /protein_id="ACR41025.1"
FT                   VQELSFTSKQFYFGERLR"
FT   gene            complement(337881..338774)
FT                   /locus_tag="M164_0395"
FT   CDS_pept        complement(337881..338774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0395"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41026"
FT                   /db_xref="GOA:C4KDQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ3"
FT                   /protein_id="ACR41026.1"
FT                   EEIDEMWEEIKKLVKK"
FT   gene            complement(338771..339928)
FT                   /locus_tag="M164_0396"
FT   CDS_pept        complement(338771..339928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0396"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41027"
FT                   /db_xref="GOA:C4KDQ4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ4"
FT                   /protein_id="ACR41027.1"
FT   gene            complement(339932..340198)
FT                   /locus_tag="M164_0397"
FT   CDS_pept        complement(339932..340198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0397"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41028"
FT                   /db_xref="GOA:C4KDQ5"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ5"
FT                   /protein_id="ACR41028.1"
FT   gene            complement(340191..340739)
FT                   /locus_tag="M164_0398"
FT   CDS_pept        complement(340191..340739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0398"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41029"
FT                   /db_xref="GOA:C4KDQ6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ6"
FT                   /protein_id="ACR41029.1"
FT   gene            340915..341091
FT                   /pseudo
FT                   /locus_tag="M164_0399"
FT   gene            complement(341198..341353)
FT                   /locus_tag="M164_2784"
FT   CDS_pept        complement(341198..341353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2784"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2784"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41030"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ7"
FT                   /protein_id="ACR41030.1"
FT                   IKRRTR"
FT   gene            complement(341461..341901)
FT                   /pseudo
FT                   /locus_tag="M164_0400"
FT   gene            complement(341940..342068)
FT                   /locus_tag="M164_0401"
FT   CDS_pept        complement(341940..342068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0401"
FT                   /product="one of two inversely orientated ORFs in a partial
FT                   ISC1043"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41031"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ8"
FT                   /protein_id="ACR41031.1"
FT   gene            complement(342126..342587)
FT                   /locus_tag="M164_0402"
FT   CDS_pept        complement(342126..342587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41032"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDQ9"
FT                   /protein_id="ACR41032.1"
FT   gene            342523..342993
FT                   /locus_tag="M164_0403"
FT   CDS_pept        342523..342993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41033"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR0"
FT                   /protein_id="ACR41033.1"
FT   gene            343170..343310
FT                   /locus_tag="M164_0404"
FT   CDS_pept        343170..343310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41034"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR1"
FT                   /protein_id="ACR41034.1"
FT                   T"
FT   gene            343331..343513
FT                   /locus_tag="M164_0405"
FT   CDS_pept        343331..343513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41035"
FT                   /db_xref="InterPro:IPR021578"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR2"
FT                   /protein_id="ACR41035.1"
FT                   KASELIRLERIKRKI"
FT   gene            343628..344971
FT                   /locus_tag="M164_0406"
FT   CDS_pept        343628..344971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0406"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41036"
FT                   /db_xref="GOA:C4KDR3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR3"
FT                   /protein_id="ACR41036.1"
FT   gene            complement(345045..345440)
FT                   /locus_tag="M164_0407"
FT   CDS_pept        complement(345045..345440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0407"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41037"
FT                   /db_xref="GOA:C4KDR4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR4"
FT                   /protein_id="ACR41037.1"
FT   gene            complement(345430..345672)
FT                   /locus_tag="M164_0408"
FT   CDS_pept        complement(345430..345672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0408"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41038"
FT                   /db_xref="GOA:C4KDR5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR5"
FT                   /protein_id="ACR41038.1"
FT   gene            complement(345813..346172)
FT                   /locus_tag="M164_0409"
FT   CDS_pept        complement(345813..346172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0409"
FT                   /product="transposase ISC1058"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41039"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR6"
FT                   /protein_id="ACR41039.1"
FT                   HLANSVVGRAPGIRV"
FT   gene            346539..348062
FT                   /locus_tag="M164_0410"
FT   CDS_pept        346539..348062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0410"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41040"
FT                   /db_xref="GOA:C4KDR7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR7"
FT                   /protein_id="ACR41040.1"
FT   gene            complement(348089..348775)
FT                   /locus_tag="M164_0411"
FT   CDS_pept        complement(348089..348775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0411"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41041"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR8"
FT                   /protein_id="ACR41041.1"
FT                   EERKDS"
FT   gene            349009..350094
FT                   /locus_tag="M164_0412"
FT   CDS_pept        349009..350094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0412"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41042"
FT                   /db_xref="GOA:C4KDR9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDR9"
FT                   /protein_id="ACR41042.1"
FT   gene            350164..350964
FT                   /locus_tag="M164_0413"
FT   CDS_pept        350164..350964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0413"
FT                   /product="Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41043"
FT                   /db_xref="GOA:C4KDS0"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS0"
FT                   /protein_id="ACR41043.1"
FT   gene            351056..351871
FT                   /locus_tag="M164_0414"
FT   CDS_pept        351056..351871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0414"
FT                   /product="Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41044"
FT                   /db_xref="GOA:C4KDS1"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS1"
FT                   /protein_id="ACR41044.1"
FT   gene            complement(351950..352957)
FT                   /locus_tag="M164_0415"
FT   CDS_pept        complement(351950..352957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0415"
FT                   /product="catechol 2,3 dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41045"
FT                   /db_xref="GOA:C4KDS2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS2"
FT                   /protein_id="ACR41045.1"
FT   gene            353062..353481
FT                   /locus_tag="M164_0416"
FT   CDS_pept        353062..353481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0416"
FT                   /product="protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41046"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS3"
FT                   /protein_id="ACR41046.1"
FT   gene            353659..354873
FT                   /locus_tag="M164_0417"
FT   CDS_pept        353659..354873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0417"
FT                   /product="FAD-dependent pyridine nucleotide-disulphideoxido
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41047"
FT                   /db_xref="GOA:C4KDS4"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS4"
FT                   /protein_id="ACR41047.1"
FT                   QKLLT"
FT   gene            354969..355130
FT                   /locus_tag="M164_0418"
FT   CDS_pept        354969..355130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41048"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS5"
FT                   /protein_id="ACR41048.1"
FT                   YKMSEMKV"
FT   gene            355209..356015
FT                   /locus_tag="M164_0419"
FT   CDS_pept        355209..356015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0419"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41049"
FT                   /db_xref="GOA:C4KDS6"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS6"
FT                   /protein_id="ACR41049.1"
FT   gene            356154..357092
FT                   /locus_tag="M164_0420"
FT   CDS_pept        356154..357092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0420"
FT                   /product="YHS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41050"
FT                   /db_xref="GOA:C4KDS7"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS7"
FT                   /protein_id="ACR41050.1"
FT   gene            357098..357532
FT                   /locus_tag="M164_0421"
FT   CDS_pept        357098..357532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS8"
FT                   /protein_id="ACR41051.1"
FT   gene            357537..357941
FT                   /locus_tag="M164_0422"
FT   CDS_pept        357537..357941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0422"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41052"
FT                   /db_xref="GOA:C4KDS9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDS9"
FT                   /protein_id="ACR41052.1"
FT   gene            357919..358266
FT                   /locus_tag="M164_0423"
FT   CDS_pept        357919..358266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0423"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41053"
FT                   /db_xref="GOA:C4KDT0"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT0"
FT                   /protein_id="ACR41053.1"
FT                   RGDYLKWYLEL"
FT   gene            358280..359410
FT                   /locus_tag="M164_0424"
FT   CDS_pept        358280..359410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0424"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41054"
FT                   /db_xref="GOA:C4KDT1"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT1"
FT                   /protein_id="ACR41054.1"
FT   gene            359407..359880
FT                   /locus_tag="M164_0425"
FT   CDS_pept        359407..359880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0425"
FT                   /product="protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41055"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT2"
FT                   /protein_id="ACR41055.1"
FT   gene            359946..361619
FT                   /locus_tag="M164_0426"
FT   CDS_pept        359946..361619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0426"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41056"
FT                   /db_xref="GOA:C4KDT3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT3"
FT                   /protein_id="ACR41056.1"
FT   gene            361644..361838
FT                   /locus_tag="M164_0427"
FT   CDS_pept        361644..361838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41057"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT4"
FT                   /protein_id="ACR41057.1"
FT   gene            complement(362377..363255)
FT                   /locus_tag="M164_0428"
FT   CDS_pept        complement(362377..363255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0428"
FT                   /product="Pirin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41058"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT5"
FT                   /protein_id="ACR41058.1"
FT                   TFIRHKEILYE"
FT   gene            complement(363858..364067)
FT                   /locus_tag="M164_0429"
FT   CDS_pept        complement(363858..364067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0429"
FT                   /product="transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41059"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT6"
FT                   /protein_id="ACR41059.1"
FT   gene            364170..365306
FT                   /locus_tag="M164_0430"
FT   CDS_pept        364170..365306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0430"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41060"
FT                   /db_xref="GOA:C4KDT7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT7"
FT                   /protein_id="ACR41060.1"
FT   gene            365506..366249
FT                   /locus_tag="M164_0431"
FT   CDS_pept        365506..366249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0431"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41061"
FT                   /db_xref="GOA:C4KDT8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT8"
FT                   /protein_id="ACR41061.1"
FT   gene            366382..367425
FT                   /locus_tag="M164_0432"
FT   CDS_pept        366382..367425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0432"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41062"
FT                   /db_xref="GOA:C4KDT9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDT9"
FT                   /protein_id="ACR41062.1"
FT                   GRQVLIP"
FT   gene            complement(367471..369285)
FT                   /locus_tag="M164_0433"
FT   CDS_pept        complement(367471..369285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0433"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41063"
FT                   /db_xref="GOA:C4KDU0"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU0"
FT                   /protein_id="ACR41063.1"
FT   gene            complement(369457..370854)
FT                   /locus_tag="M164_0434"
FT   CDS_pept        complement(369457..370854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0434"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41064"
FT                   /db_xref="GOA:C4KDU1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU1"
FT                   /protein_id="ACR41064.1"
FT                   MKEYGYP"
FT   gene            complement(370899..371492)
FT                   /locus_tag="M164_0435"
FT   CDS_pept        complement(370899..371492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41065"
FT                   /db_xref="GOA:C4KDU2"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU2"
FT                   /protein_id="ACR41065.1"
FT   gene            371584..373137
FT                   /locus_tag="M164_0436"
FT   CDS_pept        371584..373137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0436"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41066"
FT                   /db_xref="GOA:C4KDU3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU3"
FT                   /protein_id="ACR41066.1"
FT                   "
FT   gene            complement(373641..374003)
FT                   /locus_tag="M164_0437"
FT   CDS_pept        complement(373641..374003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41067"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU4"
FT                   /protein_id="ACR41067.1"
FT                   KKQYEVARKYVDSELF"
FT   gene            complement(374026..374247)
FT                   /locus_tag="M164_0438"
FT   CDS_pept        complement(374026..374247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41068"
FT                   /db_xref="InterPro:IPR039709"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU5"
FT                   /protein_id="ACR41068.1"
FT   gene            375007..375117
FT                   /locus_tag="M164_0439"
FT   CDS_pept        375007..375117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU6"
FT                   /protein_id="ACR41069.1"
FT   gene            complement(375528..376061)
FT                   /locus_tag="M164_0440"
FT   CDS_pept        complement(375528..376061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0440"
FT                   /product="Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41070"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU7"
FT                   /protein_id="ACR41070.1"
FT                   YDIFKKVFDSILKS"
FT   gene            376216..377361
FT                   /locus_tag="M164_0441"
FT   CDS_pept        376216..377361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0441"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41071"
FT                   /db_xref="GOA:C4KDU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU8"
FT                   /protein_id="ACR41071.1"
FT   gene            377366..377926
FT                   /locus_tag="M164_0442"
FT   CDS_pept        377366..377926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0442"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41072"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDU9"
FT                   /protein_id="ACR41072.1"
FT   gene            377930..378367
FT                   /locus_tag="M164_0443"
FT   CDS_pept        377930..378367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41073"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV0"
FT                   /protein_id="ACR41073.1"
FT   gene            complement(378372..379271)
FT                   /locus_tag="M164_0444"
FT   CDS_pept        complement(378372..379271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41074"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV1"
FT                   /protein_id="ACR41074.1"
FT                   YLIRARVLKLNDKQLYSD"
FT   gene            complement(379253..379933)
FT                   /locus_tag="M164_0445"
FT   CDS_pept        complement(379253..379933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41075"
FT                   /db_xref="GOA:C4KDV2"
FT                   /db_xref="InterPro:IPR017825"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV2"
FT                   /protein_id="ACR41075.1"
FT                   MKAR"
FT   gene            complement(379903..380739)
FT                   /locus_tag="M164_0446"
FT   CDS_pept        complement(379903..380739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0446"
FT                   /product="Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41076"
FT                   /db_xref="GOA:C4KDV3"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV3"
FT                   /protein_id="ACR41076.1"
FT   gene            380870..381325
FT                   /locus_tag="M164_0447"
FT   CDS_pept        380870..381325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0447"
FT                   /product="fatty acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41077"
FT                   /db_xref="GOA:C4KDV4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV4"
FT                   /protein_id="ACR41077.1"
FT   gene            381328..382689
FT                   /locus_tag="M164_0448"
FT   CDS_pept        381328..382689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0448"
FT                   /product="phytoene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41078"
FT                   /db_xref="GOA:C4KDV5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV5"
FT                   /protein_id="ACR41078.1"
FT   gene            383128..383301
FT                   /locus_tag="M164_0449"
FT   CDS_pept        383128..383301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0449"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41079"
FT                   /db_xref="GOA:C4KDV6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV6"
FT                   /protein_id="ACR41079.1"
FT                   YLTKILREKEQK"
FT   gene            complement(383328..384383)
FT                   /locus_tag="M164_0450"
FT   CDS_pept        complement(383328..384383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0450"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41080"
FT                   /db_xref="GOA:C4KDV7"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV7"
FT                   /protein_id="ACR41080.1"
FT                   LADPVLKNALA"
FT   gene            384819..385232
FT                   /locus_tag="M164_0451"
FT   CDS_pept        384819..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0451"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41081"
FT                   /db_xref="GOA:C4KDV8"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV8"
FT                   /protein_id="ACR41081.1"
FT   gene            385210..385605
FT                   /locus_tag="M164_0452"
FT   CDS_pept        385210..385605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41082"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV9"
FT                   /protein_id="ACR41082.1"
FT   gene            385904..386926
FT                   /locus_tag="M164_0453"
FT   CDS_pept        385904..386926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0453"
FT                   /product="Transposase, ISC1217"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41083"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW0"
FT                   /protein_id="ACR41083.1"
FT                   "
FT   sig_peptide     385904..385987
FT                   /locus_tag="M164_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.501 at
FT                   residue 28"
FT   gene            386947..387135
FT                   /locus_tag="M164_0454"
FT   CDS_pept        386947..387135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41084"
FT                   /db_xref="GOA:C4KDW1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW1"
FT                   /protein_id="ACR41084.1"
FT                   IVATSGVGVYKLRKSSR"
FT   gene            complement(387301..387480)
FT                   /locus_tag="M164_0455"
FT   CDS_pept        complement(387301..387480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41085"
FT                   /db_xref="GOA:C4KDW2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW2"
FT                   /protein_id="ACR41085.1"
FT                   VGIRGLMEFLGERF"
FT   sig_peptide     complement(387385..387480)
FT                   /locus_tag="M164_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.231 at
FT                   residue 32"
FT   gene            complement(387496..388473)
FT                   /locus_tag="M164_0456"
FT   CDS_pept        complement(387496..388473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0456"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41086"
FT                   /db_xref="GOA:C4KDW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW3"
FT                   /protein_id="ACR41086.1"
FT   gene            complement(388442..389380)
FT                   /locus_tag="M164_0457"
FT   CDS_pept        complement(388442..389380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0457"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41087"
FT                   /db_xref="GOA:C4KDW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW4"
FT                   /protein_id="ACR41087.1"
FT   gene            complement(389382..390734)
FT                   /locus_tag="M164_0458"
FT   CDS_pept        complement(389382..390734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0458"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41088"
FT                   /db_xref="GOA:C4KDW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW5"
FT                   /protein_id="ACR41088.1"
FT   sig_peptide     complement(390591..390734)
FT                   /locus_tag="M164_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.874 at
FT                   residue 48"
FT   gene            complement(390737..391783)
FT                   /locus_tag="M164_0459"
FT   CDS_pept        complement(390737..391783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0459"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41089"
FT                   /db_xref="GOA:C4KDW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW6"
FT                   /protein_id="ACR41089.1"
FT                   DPRIKVGE"
FT   gene            complement(391801..394467)
FT                   /locus_tag="M164_0460"
FT   CDS_pept        complement(391801..394467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41090"
FT                   /db_xref="GOA:C4KDW7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW7"
FT                   /protein_id="ACR41090.1"
FT                   VLIIIIIALAVLLFRRR"
FT   sig_peptide     complement(394375..394467)
FT                   /locus_tag="M164_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.502 at
FT                   residue 31"
FT   gene            complement(394528..395535)
FT                   /locus_tag="M164_0461"
FT   CDS_pept        complement(394528..395535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0461"
FT                   /product="protein of unknown function DUF871"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41091"
FT                   /db_xref="GOA:C4KDW8"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW8"
FT                   /protein_id="ACR41091.1"
FT   gene            395571..396023
FT                   /locus_tag="M164_0462"
FT   CDS_pept        395571..396023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0462"
FT                   /product="alanyl-tRNA synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41092"
FT                   /db_xref="GOA:C4KDW9"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW9"
FT                   /protein_id="ACR41092.1"
FT   gene            396026..397411
FT                   /locus_tag="M164_0463"
FT   CDS_pept        396026..397411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41093"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX0"
FT                   /protein_id="ACR41093.1"
FT                   EWI"
FT   gene            397402..397893
FT                   /locus_tag="M164_0464"
FT   CDS_pept        397402..397893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41094"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX1"
FT                   /protein_id="ACR41094.1"
FT                   "
FT   gene            397928..399682
FT                   /locus_tag="M164_0465"
FT   CDS_pept        397928..399682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0465"
FT                   /product="glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41095"
FT                   /db_xref="GOA:C4KDX2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX2"
FT                   /protein_id="ACR41095.1"
FT                   GLVKAVIV"
FT   gene            399718..400575
FT                   /locus_tag="M164_0466"
FT   CDS_pept        399718..400575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0466"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41096"
FT                   /db_xref="GOA:C4KDX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX3"
FT                   /protein_id="ACR41096.1"
FT                   FSNI"
FT   gene            400544..401281
FT                   /locus_tag="M164_0467"
FT   CDS_pept        400544..401281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41097"
FT                   /db_xref="GOA:C4KDX4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX4"
FT                   /protein_id="ACR41097.1"
FT   gene            401286..401834
FT                   /locus_tag="M164_0468"
FT   CDS_pept        401286..401834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41098"
FT                   /db_xref="GOA:C4KDX5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX5"
FT                   /protein_id="ACR41098.1"
FT   sig_peptide     401286..401369
FT                   /locus_tag="M164_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.807 at
FT                   residue 28"
FT   gene            401854..402381
FT                   /locus_tag="M164_0469"
FT   CDS_pept        401854..402381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41099"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX6"
FT                   /protein_id="ACR41099.1"
FT                   KIEMKSVKTTFG"
FT   gene            complement(402368..403321)
FT                   /locus_tag="M164_0470"
FT   CDS_pept        complement(402368..403321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0470"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41100"
FT                   /db_xref="GOA:C4KDX7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX7"
FT                   /protein_id="ACR41100.1"
FT   gene            403420..403722
FT                   /locus_tag="M164_0471"
FT   CDS_pept        403420..403722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0471"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41101"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX8"
FT                   /protein_id="ACR41101.1"
FT   gene            403704..404870
FT                   /locus_tag="M164_0472"
FT   CDS_pept        403704..404870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0472"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41102"
FT                   /db_xref="GOA:C4KDX9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX9"
FT                   /protein_id="ACR41102.1"
FT   gene            404873..406003
FT                   /locus_tag="M164_0473"
FT   CDS_pept        404873..406003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0473"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41103"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY0"
FT                   /protein_id="ACR41103.1"
FT   gene            406313..406537
FT                   /pseudo
FT                   /locus_tag="M164_2785"
FT   gene            complement(406571..406705)
FT                   /locus_tag="M164_0474"
FT   CDS_pept        complement(406571..406705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0474"
FT                   /product="conserved nickel transporter"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41104"
FT                   /db_xref="GOA:C4KDY1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY1"
FT                   /protein_id="ACR41104.1"
FT   gene            complement(406737..407666)
FT                   /pseudo
FT                   /locus_tag="M164_0475"
FT                   /note="conserved nickel transporter"
FT   gene            407831..408469
FT                   /locus_tag="M164_0477"
FT   CDS_pept        407831..408469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0477"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41105"
FT                   /db_xref="GOA:C4KDY2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY2"
FT                   /protein_id="ACR41105.1"
FT   gene            408500..409309
FT                   /locus_tag="M164_0478"
FT   CDS_pept        408500..409309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0478"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41106"
FT                   /db_xref="GOA:C4KDY3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY3"
FT                   /protein_id="ACR41106.1"
FT   gene            complement(409281..409709)
FT                   /locus_tag="M164_0479"
FT   CDS_pept        complement(409281..409709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0479"
FT                   /product="thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41107"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY4"
FT                   /protein_id="ACR41107.1"
FT   gene            complement(409763..410749)
FT                   /locus_tag="M164_0480"
FT   CDS_pept        complement(409763..410749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0480"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41108"
FT                   /db_xref="GOA:C4KDY5"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY5"
FT                   /protein_id="ACR41108.1"
FT   gene            410900..411113
FT                   /pseudo
FT                   /locus_tag="M164_2786"
FT   gene            complement(411464..412201)
FT                   /locus_tag="M164_0481"
FT   CDS_pept        complement(411464..412201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41109"
FT                   /db_xref="GOA:C4KDY6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY6"
FT                   /protein_id="ACR41109.1"
FT   gene            complement(412198..412461)
FT                   /locus_tag="M164_2787"
FT   CDS_pept        complement(412198..412461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41110"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY7"
FT                   /protein_id="ACR41110.1"
FT   gene            412517..412759
FT                   /locus_tag="M164_2788"
FT   CDS_pept        412517..412759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2788"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41111"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY8"
FT                   /protein_id="ACR41111.1"
FT   gene            412738..413613
FT                   /locus_tag="M164_0482"
FT   CDS_pept        412738..413613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0482"
FT                   /product="Transposase, ISC1217"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41112"
FT                   /db_xref="InterPro:IPR006783"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY9"
FT                   /protein_id="ACR41112.1"
FT                   LGLMKIFKLC"
FT   gene            complement(413627..414562)
FT                   /locus_tag="M164_0483"
FT   CDS_pept        complement(413627..414562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41113"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ0"
FT                   /protein_id="ACR41113.1"
FT   gene            415252..415989
FT                   /locus_tag="M164_0484"
FT   CDS_pept        415252..415989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41114"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ1"
FT                   /protein_id="ACR41114.1"
FT   gene            416017..416292
FT                   /locus_tag="M164_0485"
FT   CDS_pept        416017..416292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41115"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ2"
FT                   /protein_id="ACR41115.1"
FT   gene            complement(416390..417256)
FT                   /locus_tag="M164_0486"
FT   CDS_pept        complement(416390..417256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0486"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41116"
FT                   /db_xref="GOA:C4KDZ3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ3"
FT                   /protein_id="ACR41116.1"
FT                   KVYDDLS"
FT   gene            complement(417631..418278)
FT                   /locus_tag="M164_0487"
FT   CDS_pept        complement(417631..418278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0487"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41117"
FT                   /db_xref="GOA:C4KDZ4"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ4"
FT                   /protein_id="ACR41117.1"
FT   gene            418590..418796
FT                   /pseudo
FT                   /locus_tag="M164_2789"
FT   gene            419201..420271
FT                   /locus_tag="M164_0488"
FT   CDS_pept        419201..420271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0488"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41118"
FT                   /db_xref="GOA:C4KDZ5"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ5"
FT                   /protein_id="ACR41118.1"
FT                   LKEIDFEKLSFRNTFI"
FT   gene            complement(420584..421231)
FT                   /locus_tag="M164_0489"
FT   CDS_pept        complement(420584..421231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41119"
FT                   /db_xref="GOA:C4KDZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ6"
FT                   /protein_id="ACR41119.1"
FT   sig_peptide     complement(421145..421231)
FT                   /locus_tag="M164_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.775 at
FT                   residue 29"
FT   gene            421705..421869
FT                   /pseudo
FT                   /locus_tag="M164_2790"
FT   gene            complement(422020..422448)
FT                   /locus_tag="M164_0490"
FT   CDS_pept        complement(422020..422448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0490"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41120"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ7"
FT                   /protein_id="ACR41120.1"
FT   gene            complement(422441..422908)
FT                   /locus_tag="M164_0491"
FT   CDS_pept        complement(422441..422908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0491"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41121"
FT                   /db_xref="GOA:C4KDZ8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ8"
FT                   /protein_id="ACR41121.1"
FT   gene            423301..423486
FT                   /locus_tag="M164_2791"
FT   CDS_pept        423301..423486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2791"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41122"
FT                   /db_xref="GOA:C4KDZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ9"
FT                   /protein_id="ACR41122.1"
FT                   TKREFMLRETRSGGDS"
FT   gene            complement(423454..423657)
FT                   /locus_tag="M164_0492"
FT   CDS_pept        complement(423454..423657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0492"
FT                   /product="transposase ISC1190"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41123"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE00"
FT                   /protein_id="ACR41123.1"
FT   gene            423901..424101
FT                   /locus_tag="M164_0493"
FT   CDS_pept        423901..424101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41124"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE01"
FT                   /protein_id="ACR41124.1"
FT   gene            424186..424515
FT                   /locus_tag="M164_0494"
FT   CDS_pept        424186..424515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0494"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41125"
FT                   /db_xref="GOA:C4KE02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE02"
FT                   /protein_id="ACR41125.1"
FT                   VIEIA"
FT   gene            424809..426581
FT                   /locus_tag="M164_0495"
FT   CDS_pept        424809..426581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0495"
FT                   /product="arabinose ABC transporter, arabinose binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41126"
FT                   /db_xref="GOA:C4KE03"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE03"
FT                   /protein_id="ACR41126.1"
FT                   LLYLDVIIKKYNIF"
FT   gene            complement(427793..428641)
FT                   /locus_tag="M164_0496"
FT   CDS_pept        complement(427793..428641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0496"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41127"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE04"
FT                   /protein_id="ACR41127.1"
FT                   K"
FT   gene            complement(428638..429285)
FT                   /locus_tag="M164_0497"
FT   CDS_pept        complement(428638..429285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0497"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41128"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE05"
FT                   /protein_id="ACR41128.1"
FT   gene            complement(429318..430472)
FT                   /locus_tag="M164_0498"
FT   CDS_pept        complement(429318..430472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0498"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41129"
FT                   /db_xref="GOA:C4KE06"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE06"
FT                   /protein_id="ACR41129.1"
FT   gene            430536..431588
FT                   /locus_tag="M164_0499"
FT   CDS_pept        430536..431588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0499"
FT                   /product="luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41130"
FT                   /db_xref="GOA:C4KE07"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE07"
FT                   /protein_id="ACR41130.1"
FT                   GKGILLDFDN"
FT   gene            432195..432719
FT                   /locus_tag="M164_0500"
FT   CDS_pept        432195..432719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE08"
FT                   /protein_id="ACR41131.1"
FT                   RVKLGKNFKNT"
FT   gene            433425..433574
FT                   /locus_tag="M164_0501"
FT   CDS_pept        433425..433574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0501"
FT                   /product="transposase ISC1229"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41132"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE09"
FT                   /protein_id="ACR41132.1"
FT                   ECLV"
FT   gene            complement(433592..433789)
FT                   /locus_tag="M164_0502"
FT   CDS_pept        complement(433592..433789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41133"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE10"
FT                   /protein_id="ACR41133.1"
FT   gene            complement(434084..434245)
FT                   /locus_tag="M164_0503"
FT   CDS_pept        complement(434084..434245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41134"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE11"
FT                   /protein_id="ACR41134.1"
FT                   YTEDDLRS"
FT   gene            complement(434372..434875)
FT                   /locus_tag="M164_0504"
FT   CDS_pept        complement(434372..434875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41135"
FT                   /db_xref="GOA:C4KE12"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE12"
FT                   /protein_id="ACR41135.1"
FT                   GKKQ"
FT   gene            complement(434917..435846)
FT                   /locus_tag="M164_0505"
FT   CDS_pept        complement(434917..435846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41136"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR029461"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE13"
FT                   /protein_id="ACR41136.1"
FT   gene            complement(435884..435979)
FT                   /locus_tag="M164_0506"
FT   CDS_pept        complement(435884..435979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41137"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE14"
FT                   /protein_id="ACR41137.1"
FT                   /translation="MSEGKKKQQVDPCFLAWVYLLEVMEKKEKKD"
FT   gene            complement(435976..436749)
FT                   /locus_tag="M164_0507"
FT   CDS_pept        complement(435976..436749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0507"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41138"
FT                   /db_xref="GOA:C4KE15"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE15"
FT                   /protein_id="ACR41138.1"
FT   gene            complement(436820..438634)
FT                   /locus_tag="M164_0508"
FT   CDS_pept        complement(436820..438634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0508"
FT                   /product="Peptidase S53 propeptide"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41139"
FT                   /db_xref="GOA:C4KE16"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE16"
FT                   /protein_id="ACR41139.1"
FT   sig_peptide     complement(438539..438616)
FT                   /locus_tag="M164_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 26"
FT   gene            complement(438681..439307)
FT                   /locus_tag="M164_0509"
FT   CDS_pept        complement(438681..439307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0509"
FT                   /product="transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41140"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE17"
FT                   /protein_id="ACR41140.1"
FT   gene            439429..441525
FT                   /locus_tag="M164_0510"
FT   CDS_pept        439429..441525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0510"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41141"
FT                   /db_xref="GOA:C4KE18"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE18"
FT                   /protein_id="ACR41141.1"
FT                   GLFE"
FT   gene            441575..442060
FT                   /locus_tag="M164_0511"
FT   CDS_pept        441575..442060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41142"
FT                   /db_xref="GOA:C4KE19"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE19"
FT                   /protein_id="ACR41142.1"
FT   gene            442080..443765
FT                   /locus_tag="M164_0512"
FT   CDS_pept        442080..443765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0512"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41143"
FT                   /db_xref="GOA:C4KE20"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015156"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE20"
FT                   /protein_id="ACR41143.1"
FT   gene            443934..446090
FT                   /locus_tag="M164_0513"
FT   CDS_pept        443934..446090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0513"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41144"
FT                   /db_xref="GOA:C4KE21"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE21"
FT                   /protein_id="ACR41144.1"
FT   gene            446087..448273
FT                   /locus_tag="M164_0514"
FT   CDS_pept        446087..448273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0514"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41145"
FT                   /db_xref="GOA:C4KE22"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE22"
FT                   /protein_id="ACR41145.1"
FT   gene            448377..448607
FT                   /locus_tag="M164_0515"
FT   CDS_pept        448377..448607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41146"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE23"
FT                   /protein_id="ACR41146.1"
FT   gene            448693..448950
FT                   /pseudo
FT                   /locus_tag="M164_2792"
FT   gene            complement(449744..452770)
FT                   /locus_tag="M164_0516"
FT   CDS_pept        complement(449744..452770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0516"
FT                   /product="peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41147"
FT                   /db_xref="GOA:C4KE24"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR029414"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE24"
FT                   /protein_id="ACR41147.1"
FT   gene            452980..453615
FT                   /locus_tag="M164_0517"
FT   CDS_pept        452980..453615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0517"
FT                   /product="2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)
FT                   pyrimidine1-reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41148"
FT                   /db_xref="GOA:C4KE25"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE25"
FT                   /protein_id="ACR41148.1"
FT   gene            453840..454190
FT                   /locus_tag="M164_0518"
FT   CDS_pept        453840..454190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41149"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF2"
FT                   /protein_id="ACR41149.1"
FT                   VKVYDPLRGRSI"
FT   gene            454298..454585
FT                   /locus_tag="M164_0519"
FT   CDS_pept        454298..454585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41150"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF3"
FT                   /protein_id="ACR41150.1"
FT   gene            454546..455094
FT                   /locus_tag="M164_0520"
FT   CDS_pept        454546..455094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41151"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF4"
FT                   /protein_id="ACR41151.1"
FT   gene            455508..456314
FT                   /locus_tag="M164_0521"
FT   CDS_pept        455508..456314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0521"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41152"
FT                   /db_xref="GOA:C4KEF5"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF5"
FT                   /protein_id="ACR41152.1"
FT   gene            456498..456866
FT                   /locus_tag="M164_0522"
FT   CDS_pept        456498..456866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41153"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF6"
FT                   /protein_id="ACR41153.1"
FT                   GLTLFHNEFLGVWTNPYA"
FT   gene            complement(458244..458579)
FT                   /locus_tag="M164_0523"
FT   CDS_pept        complement(458244..458579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41154"
FT                   /db_xref="GOA:C4KEF7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF7"
FT                   /protein_id="ACR41154.1"
FT                   PLLSMAL"
FT   gene            complement(458589..458855)
FT                   /locus_tag="M164_0524"
FT   CDS_pept        complement(458589..458855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0524"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41155"
FT                   /db_xref="GOA:C4KEF8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF8"
FT                   /protein_id="ACR41155.1"
FT   gene            complement(458815..459144)
FT                   /locus_tag="M164_0525"
FT   CDS_pept        complement(458815..459144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41156"
FT                   /db_xref="GOA:C4KEF9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF9"
FT                   /protein_id="ACR41156.1"
FT                   PKFRR"
FT   gene            complement(459183..460055)
FT                   /locus_tag="M164_0526"
FT   CDS_pept        complement(459183..460055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41157"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG0"
FT                   /protein_id="ACR41157.1"
FT                   ISYTTSQLY"
FT   sig_peptide     complement(459978..460055)
FT                   /locus_tag="M164_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.832 at
FT                   residue 26"
FT   gene            complement(460099..460446)
FT                   /locus_tag="M164_0527"
FT   CDS_pept        complement(460099..460446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41158"
FT                   /db_xref="GOA:C4KEG1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG1"
FT                   /protein_id="ACR41158.1"
FT                   ALTIFLLIRRK"
FT   sig_peptide     complement(460333..460446)
FT                   /locus_tag="M164_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.680 at
FT                   residue 38"
FT   gene            complement(460501..460836)
FT                   /locus_tag="M164_0528"
FT   CDS_pept        complement(460501..460836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41159"
FT                   /db_xref="GOA:C4KEG2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG2"
FT                   /protein_id="ACR41159.1"
FT                   PMIRPKN"
FT   gene            complement(460870..461166)
FT                   /locus_tag="M164_0529"
FT   CDS_pept        complement(460870..461166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41160"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG3"
FT                   /protein_id="ACR41160.1"
FT   gene            461464..461901
FT                   /locus_tag="M164_0530"
FT   CDS_pept        461464..461901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0530"
FT                   /product="Vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41161"
FT                   /db_xref="GOA:C4KEG4"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG4"
FT                   /protein_id="ACR41161.1"
FT   gene            461898..462104
FT                   /locus_tag="M164_0531"
FT   CDS_pept        461898..462104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41162"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG5"
FT                   /protein_id="ACR41162.1"
FT   gene            complement(462406..462663)
FT                   /locus_tag="M164_0532"
FT   CDS_pept        complement(462406..462663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41163"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG6"
FT                   /protein_id="ACR41163.1"
FT   gene            462740..463369
FT                   /locus_tag="M164_0533"
FT   CDS_pept        462740..463369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0533"
FT                   /product="Pyroglutamyl-peptidase I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41164"
FT                   /db_xref="GOA:C4KEG7"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KEG7"
FT                   /protein_id="ACR41164.1"
FT   gene            complement(463460..464368)
FT                   /locus_tag="M164_0534"
FT   CDS_pept        complement(463460..464368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41165"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG8"
FT                   /protein_id="ACR41165.1"
FT   gene            464654..465226
FT                   /locus_tag="M164_0535"
FT   CDS_pept        464654..465226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0535"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41166"
FT                   /db_xref="GOA:C4KEG9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG9"
FT                   /protein_id="ACR41166.1"
FT   gene            complement(465874..466376)
FT                   /pseudo
FT                   /locus_tag="M164_0536"
FT   gene            467036..467586
FT                   /pseudo
FT                   /locus_tag="M164_0537"
FT   gene            complement(467645..468514)
FT                   /locus_tag="M164_0538"
FT   CDS_pept        complement(467645..468514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0538"
FT                   /product="major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41167"
FT                   /db_xref="GOA:C4KEH0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH0"
FT                   /protein_id="ACR41167.1"
FT                   FVKNINKK"
FT   gene            complement(468515..470020)
FT                   /locus_tag="M164_0539"
FT   CDS_pept        complement(468515..470020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0539"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41168"
FT                   /db_xref="GOA:C4KEH1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KEH1"
FT                   /protein_id="ACR41168.1"
FT   gene            complement(470323..471313)
FT                   /pseudo
FT                   /locus_tag="M164_0540"
FT   gene            471987..473627
FT                   /locus_tag="M164_0541"
FT   CDS_pept        471987..473627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0541"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41169"
FT                   /db_xref="GOA:C4KEH2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH2"
FT                   /protein_id="ACR41169.1"
FT   gene            473639..475183
FT                   /locus_tag="M164_0542"
FT   CDS_pept        473639..475183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0542"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41170"
FT                   /db_xref="GOA:C4KEH3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH3"
FT                   /protein_id="ACR41170.1"
FT   gene            complement(475371..476795)
FT                   /locus_tag="M164_0543"
FT   CDS_pept        complement(475371..476795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0543"
FT                   /product="medium-chain-fatty-acid--CoA ligase (AlkK-1)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41171"
FT                   /db_xref="GOA:C4KEH4"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH4"
FT                   /protein_id="ACR41171.1"
FT                   WTGYKLQVFVDQRKKK"
FT   gene            476972..477514
FT                   /locus_tag="M164_0544"
FT   CDS_pept        476972..477514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0544"
FT                   /product="protein of unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41172"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH5"
FT                   /protein_id="ACR41172.1"
FT                   AYDIRNTIVELLFKGDD"
FT   gene            477651..478958
FT                   /locus_tag="M164_0545"
FT   CDS_pept        477651..478958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0545"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41173"
FT                   /db_xref="GOA:C4KEH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH6"
FT                   /protein_id="ACR41173.1"
FT   gene            complement(478928..479626)
FT                   /locus_tag="M164_0546"
FT   CDS_pept        complement(478928..479626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0546"
FT                   /product="transporter (proton symporter)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41174"
FT                   /db_xref="GOA:C4KEH7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH7"
FT                   /protein_id="ACR41174.1"
FT                   YYRSTSSKDT"
FT   gene            complement(479633..480667)
FT                   /locus_tag="M164_0547"
FT   CDS_pept        complement(479633..480667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41175"
FT                   /db_xref="GOA:C4KEH8"
FT                   /db_xref="InterPro:IPR014574"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH8"
FT                   /protein_id="ACR41175.1"
FT                   ILVK"
FT   gene            complement(480673..481026)
FT                   /locus_tag="M164_0548"
FT   CDS_pept        complement(480673..481026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0548"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41176"
FT                   /db_xref="GOA:C4KEH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH9"
FT                   /protein_id="ACR41176.1"
FT                   RDEILFFISALLR"
FT   gene            complement(481152..481489)
FT                   /pseudo
FT                   /locus_tag="M164_0549"
FT   gene            481875..482786
FT                   /locus_tag="M164_0550"
FT   CDS_pept        481875..482786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41177"
FT                   /db_xref="GOA:C4KEI0"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI0"
FT                   /protein_id="ACR41177.1"
FT   gene            482965..483816
FT                   /locus_tag="M164_0551"
FT   CDS_pept        482965..483816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41178"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI1"
FT                   /protein_id="ACR41178.1"
FT                   LA"
FT   gene            complement(483904..485403)
FT                   /locus_tag="M164_0552"
FT   CDS_pept        complement(483904..485403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41179"
FT                   /db_xref="GOA:C4KEI2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI2"
FT                   /protein_id="ACR41179.1"
FT   sig_peptide     complement(485338..485403)
FT                   /locus_tag="M164_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 22"
FT   gene            complement(485532..486425)
FT                   /locus_tag="M164_0553"
FT   CDS_pept        complement(485532..486425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0553"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41180"
FT                   /db_xref="GOA:C4KEI3"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI3"
FT                   /protein_id="ACR41180.1"
FT                   IGGNIINISTTAVYQP"
FT   sig_peptide     complement(486276..486425)
FT                   /locus_tag="M164_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.237 at
FT                   residue 50"
FT   gene            complement(486448..488335)
FT                   /pseudo
FT                   /locus_tag="M164_0554"
FT                   /note="conserved hypothetical protein"
FT   gene            488611..491763
FT                   /locus_tag="M164_0556"
FT   CDS_pept        488611..491763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0556"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41181"
FT                   /db_xref="GOA:C4KEI4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI4"
FT                   /protein_id="ACR41181.1"
FT                   LG"
FT   gene            491770..492456
FT                   /locus_tag="M164_0557"
FT   CDS_pept        491770..492456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0557"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41182"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI5"
FT                   /protein_id="ACR41182.1"
FT                   GGGGNS"
FT   gene            492453..493748
FT                   /locus_tag="M164_0558"
FT   CDS_pept        492453..493748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0558"
FT                   /product="Polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41183"
FT                   /db_xref="GOA:C4KEI6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI6"
FT                   /protein_id="ACR41183.1"
FT   sig_peptide     492453..492551
FT                   /locus_tag="M164_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.921 at
FT                   residue 33"
FT   gene            493755..495122
FT                   /locus_tag="M164_0559"
FT   CDS_pept        493755..495122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0559"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41184"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI7"
FT                   /protein_id="ACR41184.1"
FT   gene            495119..495661
FT                   /locus_tag="M164_0560"
FT   CDS_pept        495119..495661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0560"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41185"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI8"
FT                   /protein_id="ACR41185.1"
FT                   LKQFLDYAIQNIFVVNR"
FT   gene            complement(496189..497148)
FT                   /locus_tag="M164_0561"
FT   CDS_pept        complement(496189..497148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0561"
FT                   /product="Transposase, ISC1234/ST1916, Sulfolobus"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41186"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEI9"
FT                   /protein_id="ACR41186.1"
FT   gene            complement(497535..497981)
FT                   /locus_tag="M164_0562"
FT   CDS_pept        complement(497535..497981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0562"
FT                   /product="transposase ISC1250"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41187"
FT                   /db_xref="GOA:C4KEJ0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ0"
FT                   /protein_id="ACR41187.1"
FT   gene            498605..498832
FT                   /locus_tag="M164_0563"
FT   CDS_pept        498605..498832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41188"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ1"
FT                   /protein_id="ACR41188.1"
FT   gene            498795..499142
FT                   /locus_tag="M164_0564"
FT   CDS_pept        498795..499142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41189"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ2"
FT                   /protein_id="ACR41189.1"
FT                   LIIQVLMFSLV"
FT   gene            499369..499509
FT                   /locus_tag="M164_0565"
FT   CDS_pept        499369..499509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41190"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ3"
FT                   /protein_id="ACR41190.1"
FT                   F"
FT   gene            complement(499778..502087)
FT                   /locus_tag="M164_0566"
FT   CDS_pept        complement(499778..502087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41191"
FT                   /db_xref="GOA:C4KEJ4"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ4"
FT                   /protein_id="ACR41191.1"
FT                   LLVDTIIPIIIYLNLK"
FT   gene            502524..506990
FT                   /locus_tag="M164_0567"
FT   CDS_pept        502524..506990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0567"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41192"
FT                   /db_xref="GOA:C4KEJ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ5"
FT                   /protein_id="ACR41192.1"
FT   gene            507137..507394
FT                   /pseudo
FT                   /locus_tag="M164_0568"
FT   gene            507894..508262
FT                   /locus_tag="M164_0569"
FT   CDS_pept        507894..508262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0569"
FT                   /product="ORF1 in transposon ISC1078"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41193"
FT                   /db_xref="GOA:C4KEJ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ6"
FT                   /protein_id="ACR41193.1"
FT                   EKTVEGWVKEQGEKLLKK"
FT   gene            508467..508805
FT                   /locus_tag="M164_0570"
FT   CDS_pept        508467..508805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0570"
FT                   /product="ORF2 in transposon ISC1078"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41194"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ7"
FT                   /protein_id="ACR41194.1"
FT                   EVPLPFKV"
FT   gene            complement(509053..509439)
FT                   /locus_tag="M164_0571"
FT   CDS_pept        complement(509053..509439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0571"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41195"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ8"
FT                   /protein_id="ACR41195.1"
FT   gene            complement(509470..509853)
FT                   /locus_tag="M164_0572"
FT   CDS_pept        complement(509470..509853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41196"
FT                   /db_xref="GOA:C4KEJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEJ9"
FT                   /protein_id="ACR41196.1"
FT   gene            complement(509837..510394)
FT                   /locus_tag="M164_0573"
FT   CDS_pept        complement(509837..510394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41197"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK0"
FT                   /protein_id="ACR41197.1"
FT   gene            complement(510816..511502)
FT                   /locus_tag="M164_0574"
FT   CDS_pept        complement(510816..511502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0574"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41198"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK1"
FT                   /protein_id="ACR41198.1"
FT                   ITIKNL"
FT   gene            complement(511502..512686)
FT                   /locus_tag="M164_0575"
FT   CDS_pept        complement(511502..512686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0575"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41199"
FT                   /db_xref="GOA:C4KEK2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK2"
FT                   /protein_id="ACR41199.1"
FT   gene            512952..513468
FT                   /pseudo
FT                   /locus_tag="M164_0576"
FT   gene            513495..513809
FT                   /locus_tag="M164_0577"
FT   CDS_pept        513495..513809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0577"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41200"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK3"
FT                   /protein_id="ACR41200.1"
FT                   "
FT   gene            514110..515393
FT                   /locus_tag="M164_0578"
FT   CDS_pept        514110..515393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0578"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41201"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK4"
FT                   /protein_id="ACR41201.1"
FT   gene            complement(515363..515760)
FT                   /pseudo
FT                   /locus_tag="M164_0579"
FT   gene            516899..517597
FT                   /locus_tag="M164_0580"
FT   CDS_pept        516899..517597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0580"
FT                   /product="protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41202"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK5"
FT                   /protein_id="ACR41202.1"
FT                   QGGPGFNIRI"
FT   gene            complement(517934..518632)
FT                   /locus_tag="M164_0581"
FT   CDS_pept        complement(517934..518632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41203"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK6"
FT                   /protein_id="ACR41203.1"
FT                   VIINVNISNE"
FT   gene            complement(518852..520462)
FT                   /locus_tag="M164_0582"
FT   CDS_pept        complement(518852..520462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0582"
FT                   /product="Acylaminoacyl-peptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41204"
FT                   /db_xref="GOA:C4KEK7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK7"
FT                   /protein_id="ACR41204.1"
FT   gene            521180..522383
FT                   /pseudo
FT                   /locus_tag="M164_0583"
FT   gene            complement(522594..524333)
FT                   /locus_tag="M164_0584"
FT   CDS_pept        complement(522594..524333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0584"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41205"
FT                   /db_xref="GOA:C4KEK8"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK8"
FT                   /protein_id="ACR41205.1"
FT                   NKI"
FT   gene            complement(524336..526387)
FT                   /locus_tag="M164_0585"
FT   CDS_pept        complement(524336..526387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0585"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41206"
FT                   /db_xref="GOA:C4KEK9"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEK9"
FT                   /protein_id="ACR41206.1"
FT   gene            526583..527062
FT                   /locus_tag="M164_0586"
FT   CDS_pept        526583..527062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0586"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41207"
FT                   /db_xref="GOA:C4KEL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL0"
FT                   /protein_id="ACR41207.1"
FT   gene            527232..528593
FT                   /locus_tag="M164_0587"
FT   CDS_pept        527232..528593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0587"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41208"
FT                   /db_xref="GOA:C4KEL1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL1"
FT                   /protein_id="ACR41208.1"
FT   gene            528590..528976
FT                   /locus_tag="M164_0588"
FT   CDS_pept        528590..528976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41209"
FT                   /db_xref="GOA:C4KEL2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL2"
FT                   /protein_id="ACR41209.1"
FT   gene            528981..530063
FT                   /locus_tag="M164_0589"
FT   CDS_pept        528981..530063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0589"
FT                   /product="protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41210"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL3"
FT                   /protein_id="ACR41210.1"
FT   gene            530011..531594
FT                   /locus_tag="M164_0590"
FT   CDS_pept        530011..531594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0590"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41211"
FT                   /db_xref="GOA:C4KEL4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL4"
FT                   /protein_id="ACR41211.1"
FT                   VKVKVVGEFS"
FT   gene            complement(531569..532615)
FT                   /locus_tag="M164_0591"
FT   CDS_pept        complement(531569..532615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0591"
FT                   /product="protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41212"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL5"
FT                   /protein_id="ACR41212.1"
FT                   IKKIRQLP"
FT   gene            533146..533490
FT                   /locus_tag="M164_0592"
FT   CDS_pept        533146..533490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0592"
FT                   /product="conserved hypothetical insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41213"
FT                   /db_xref="GOA:C4KEL6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL6"
FT                   /protein_id="ACR41213.1"
FT                   KCVEDVEKDS"
FT   gene            533462..534787
FT                   /locus_tag="M164_0593"
FT   CDS_pept        533462..534787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0593"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41214"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL7"
FT                   /protein_id="ACR41214.1"
FT   gene            535128..535832
FT                   /locus_tag="M164_0594"
FT   CDS_pept        535128..535832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0594"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41215"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL8"
FT                   /protein_id="ACR41215.1"
FT                   YQQDLLFHSPDY"
FT   gene            535935..537326
FT                   /locus_tag="M164_0595"
FT   CDS_pept        535935..537326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0595"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41216"
FT                   /db_xref="GOA:C4KEL9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEL9"
FT                   /protein_id="ACR41216.1"
FT                   PLGNK"
FT   gene            complement(537331..538449)
FT                   /locus_tag="M164_0596"
FT   CDS_pept        complement(537331..538449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0596"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41217"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM0"
FT                   /protein_id="ACR41217.1"
FT   gene            538577..539656
FT                   /locus_tag="M164_0597"
FT   CDS_pept        538577..539656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0597"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41218"
FT                   /db_xref="GOA:C4KEM1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM1"
FT                   /protein_id="ACR41218.1"
FT   gene            complement(539883..540029)
FT                   /pseudo
FT                   /locus_tag="M164_0598"
FT   gene            540526..540885
FT                   /locus_tag="M164_0599"
FT   CDS_pept        540526..540885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41219"
FT                   /db_xref="GOA:C4KEM2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM2"
FT                   /protein_id="ACR41219.1"
FT                   VAIGSSYGILTSSPP"
FT   gene            complement(540855..542186)
FT                   /locus_tag="M164_0600"
FT   CDS_pept        complement(540855..542186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0600"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41220"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM3"
FT                   /protein_id="ACR41220.1"
FT   gene            complement(542173..542583)
FT                   /locus_tag="M164_0601"
FT   CDS_pept        complement(542173..542583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0601"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41221"
FT                   /db_xref="GOA:C4KEM4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM4"
FT                   /protein_id="ACR41221.1"
FT   gene            complement(542585..542734)
FT                   /pseudo
FT                   /locus_tag="M164_0602"
FT   gene            complement(542753..543676)
FT                   /locus_tag="M164_0603"
FT   CDS_pept        complement(542753..543676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41222"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM5"
FT                   /protein_id="ACR41222.1"
FT   gene            complement(543729..544130)
FT                   /locus_tag="M164_0604"
FT   CDS_pept        complement(543729..544130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0604"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41223"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM6"
FT                   /protein_id="ACR41223.1"
FT   gene            complement(544436..545647)
FT                   /locus_tag="M164_0605"
FT   CDS_pept        complement(544436..545647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0605"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41224"
FT                   /db_xref="GOA:C4KEM7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM7"
FT                   /protein_id="ACR41224.1"
FT                   AKGS"
FT   gene            545836..547128
FT                   /locus_tag="M164_0606"
FT   CDS_pept        545836..547128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0606"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41225"
FT                   /db_xref="GOA:C4KEM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM8"
FT                   /protein_id="ACR41225.1"
FT   gene            547143..547994
FT                   /locus_tag="M164_0607"
FT   CDS_pept        547143..547994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0607"
FT                   /product="peptidase S58 DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41226"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEM9"
FT                   /protein_id="ACR41226.1"
FT                   FR"
FT   gene            548001..548759
FT                   /locus_tag="M164_0608"
FT   CDS_pept        548001..548759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0608"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41227"
FT                   /db_xref="GOA:C4KEN0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN0"
FT                   /protein_id="ACR41227.1"
FT   gene            548765..549046
FT                   /pseudo
FT                   /locus_tag="M164_2793"
FT   gene            complement(549270..549683)
FT                   /locus_tag="M164_0609"
FT   CDS_pept        complement(549270..549683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0609"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41228"
FT                   /db_xref="InterPro:IPR001024"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN1"
FT                   /protein_id="ACR41228.1"
FT   gene            complement(549655..549867)
FT                   /locus_tag="M164_0610"
FT   CDS_pept        complement(549655..549867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41229"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN2"
FT                   /protein_id="ACR41229.1"
FT   gene            550050..550178
FT                   /locus_tag="M164_0611"
FT   CDS_pept        550050..550178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41230"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN3"
FT                   /protein_id="ACR41230.1"
FT   gene            complement(551031..551804)
FT                   /locus_tag="M164_0612"
FT   CDS_pept        complement(551031..551804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41231"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN4"
FT                   /protein_id="ACR41231.1"
FT   gene            complement(551901..553139)
FT                   /locus_tag="M164_0613"
FT   CDS_pept        complement(551901..553139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0613"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41232"
FT                   /db_xref="GOA:C4KEN5"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN5"
FT                   /protein_id="ACR41232.1"
FT                   SPRGGDAPSVRAG"
FT   gene            complement(553114..553521)
FT                   /locus_tag="M164_0614"
FT   CDS_pept        complement(553114..553521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0614"
FT                   /product="transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41233"
FT                   /db_xref="GOA:C4KEN6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN6"
FT                   /protein_id="ACR41233.1"
FT   gene            complement(553670..554026)
FT                   /locus_tag="M164_0615"
FT   CDS_pept        complement(553670..554026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41234"
FT                   /db_xref="GOA:C4KEN7"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN7"
FT                   /protein_id="ACR41234.1"
FT                   PLKREIRQGRIIMK"
FT   gene            complement(554570..555256)
FT                   /locus_tag="M164_0616"
FT   CDS_pept        complement(554570..555256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41235"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN8"
FT                   /protein_id="ACR41235.1"
FT                   NSNRKF"
FT   gene            complement(555634..555924)
FT                   /locus_tag="M164_0617"
FT   CDS_pept        complement(555634..555924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0617"
FT                   /product="conserved hypothetical PepK protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEN9"
FT                   /protein_id="ACR41236.1"
FT   gene            complement(555893..556099)
FT                   /locus_tag="M164_0618"
FT   CDS_pept        complement(555893..556099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41237"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP0"
FT                   /protein_id="ACR41237.1"
FT   gene            complement(556170..556346)
FT                   /locus_tag="M164_0619"
FT   CDS_pept        complement(556170..556346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41238"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP1"
FT                   /protein_id="ACR41238.1"
FT                   SIMNEHKMSEMKV"
FT   gene            complement(556377..556676)
FT                   /pseudo
FT                   /locus_tag="M164_2794"
FT   gene            complement(556667..557020)
FT                   /locus_tag="M164_0620"
FT   CDS_pept        complement(556667..557020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41239"
FT                   /db_xref="GOA:C4KEP2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP2"
FT                   /protein_id="ACR41239.1"
FT                   ITLLSAILILTCI"
FT   gene            complement(557007..557198)
FT                   /pseudo
FT                   /locus_tag="M164_2795"
FT   gene            complement(557395..557520)
FT                   /pseudo
FT                   /locus_tag="M164_2796"
FT   gene            557633..557887
FT                   /locus_tag="M164_0621"
FT   CDS_pept        557633..557887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0621"
FT                   /product="Protein of unknown function DUF217"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41240"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP3"
FT                   /protein_id="ACR41240.1"
FT   gene            557853..558227
FT                   /locus_tag="M164_0622"
FT   CDS_pept        557853..558227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0622"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41241"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP4"
FT                   /protein_id="ACR41241.1"
FT   gene            complement(558441..558728)
FT                   /locus_tag="M164_0623"
FT   CDS_pept        complement(558441..558728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41242"
FT                   /db_xref="GOA:C4KEP5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP5"
FT                   /protein_id="ACR41242.1"
FT   gene            complement(558828..559013)
FT                   /locus_tag="M164_0624"
FT   CDS_pept        complement(558828..559013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0624"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41243"
FT                   /db_xref="GOA:C4KEP6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP6"
FT                   /protein_id="ACR41243.1"
FT                   VNYINIERLEEIVNER"
FT   gene            complement(559579..560106)
FT                   /locus_tag="M164_0625"
FT   CDS_pept        complement(559579..560106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0625"
FT                   /product="PaREP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41244"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP7"
FT                   /protein_id="ACR41244.1"
FT                   KELEELLKNTFN"
FT   gene            complement(560307..560912)
FT                   /locus_tag="M164_0626"
FT   CDS_pept        complement(560307..560912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41245"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP8"
FT                   /protein_id="ACR41245.1"
FT   gene            complement(560918..561817)
FT                   /locus_tag="M164_0627"
FT   CDS_pept        complement(560918..561817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41246"
FT                   /db_xref="GOA:C4KEP9"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEP9"
FT                   /protein_id="ACR41246.1"
FT                   KLSEISEFEKPLSWLGYV"
FT   gene            562396..562854
FT                   /locus_tag="M164_0628"
FT   CDS_pept        562396..562854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0628"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41247"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ0"
FT                   /protein_id="ACR41247.1"
FT   gene            562867..563751
FT                   /locus_tag="M164_0629"
FT   CDS_pept        562867..563751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41248"
FT                   /db_xref="GOA:C4KEQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ1"
FT                   /protein_id="ACR41248.1"
FT                   NIMSFLEVKNTDY"
FT   gene            complement(564035..565393)
FT                   /locus_tag="M164_0630"
FT   CDS_pept        complement(564035..565393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0630"
FT                   /product="Thermopsin"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41249"
FT                   /db_xref="GOA:C4KEQ2"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ2"
FT                   /protein_id="ACR41249.1"
FT   sig_peptide     complement(565325..565393)
FT                   /locus_tag="M164_0630"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.496 at
FT                   residue 23"
FT   gene            565697..566971
FT                   /locus_tag="M164_0631"
FT   CDS_pept        565697..566971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41250"
FT                   /db_xref="GOA:C4KEQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ3"
FT                   /protein_id="ACR41250.1"
FT   gene            567484..569241
FT                   /locus_tag="M164_0632"
FT   CDS_pept        567484..569241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0632"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41251"
FT                   /db_xref="GOA:C4KEQ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ4"
FT                   /protein_id="ACR41251.1"
FT                   KEKENNEEK"
FT   gene            569806..570096
FT                   /locus_tag="M164_0633"
FT   CDS_pept        569806..570096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41252"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ5"
FT                   /protein_id="ACR41252.1"
FT   gene            complement(570306..571262)
FT                   /locus_tag="M164_0634"
FT   CDS_pept        complement(570306..571262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0634"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41253"
FT                   /db_xref="GOA:C4KEQ6"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ6"
FT                   /protein_id="ACR41253.1"
FT   gene            complement(571284..572318)
FT                   /locus_tag="M164_0635"
FT   CDS_pept        complement(571284..572318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0635"
FT                   /product="glucose-1-phosphate thymidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41254"
FT                   /db_xref="GOA:C4KEQ7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ7"
FT                   /protein_id="ACR41254.1"
FT                   SVII"
FT   gene            complement(572319..573146)
FT                   /locus_tag="M164_0636"
FT   CDS_pept        complement(572319..573146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0636"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41255"
FT                   /db_xref="GOA:C4KEQ8"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ8"
FT                   /protein_id="ACR41255.1"
FT   gene            573301..574965
FT                   /locus_tag="M164_0637"
FT   CDS_pept        573301..574965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0637"
FT                   /product="phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41256"
FT                   /db_xref="GOA:C4KEQ9"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEQ9"
FT                   /protein_id="ACR41256.1"
FT   sig_peptide     573301..573441
FT                   /locus_tag="M164_0637"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.690) with cleavage site probability 0.240 at
FT                   residue 47"
FT   gene            complement(574996..575442)
FT                   /locus_tag="M164_0638"
FT   CDS_pept        complement(574996..575442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41257"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER0"
FT                   /protein_id="ACR41257.1"
FT   gene            complement(575462..576916)
FT                   /locus_tag="M164_0639"
FT   CDS_pept        complement(575462..576916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41258"
FT                   /db_xref="GOA:C4KER1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER1"
FT                   /protein_id="ACR41258.1"
FT   gene            complement(576919..578079)
FT                   /locus_tag="M164_0640"
FT   CDS_pept        complement(576919..578079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41259"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER2"
FT                   /protein_id="ACR41259.1"
FT   gene            complement(578584..579267)
FT                   /locus_tag="M164_0641"
FT   CDS_pept        complement(578584..579267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41260"
FT                   /db_xref="GOA:C4KER3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER3"
FT                   /protein_id="ACR41260.1"
FT                   IGILE"
FT   gene            complement(579273..580355)
FT                   /locus_tag="M164_0642"
FT   CDS_pept        complement(579273..580355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0642"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41261"
FT                   /db_xref="GOA:C4KER4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER4"
FT                   /protein_id="ACR41261.1"
FT   gene            complement(580334..581398)
FT                   /locus_tag="M164_0643"
FT   CDS_pept        complement(580334..581398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0643"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41262"
FT                   /db_xref="GOA:C4KER5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER5"
FT                   /protein_id="ACR41262.1"
FT                   ALRGEVLAWRKEKK"
FT   gene            581576..582691
FT                   /locus_tag="M164_0644"
FT   CDS_pept        581576..582691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0644"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41263"
FT                   /db_xref="GOA:C4KER6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER6"
FT                   /protein_id="ACR41263.1"
FT   gene            582894..583895
FT                   /locus_tag="M164_0645"
FT   CDS_pept        582894..583895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0645"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41264"
FT                   /db_xref="GOA:C4KER7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER7"
FT                   /protein_id="ACR41264.1"
FT   gene            complement(584341..585444)
FT                   /locus_tag="M164_0646"
FT   CDS_pept        complement(584341..585444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0646"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41265"
FT                   /db_xref="GOA:C4KER8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER8"
FT                   /protein_id="ACR41265.1"
FT   gene            complement(585990..586463)
FT                   /locus_tag="M164_0647"
FT   CDS_pept        complement(585990..586463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41266"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KER9"
FT                   /protein_id="ACR41266.1"
FT   gene            complement(587121..588107)
FT                   /locus_tag="M164_0648"
FT   CDS_pept        complement(587121..588107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0648"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41267"
FT                   /db_xref="GOA:C4KES0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES0"
FT                   /protein_id="ACR41267.1"
FT   gene            complement(588125..589045)
FT                   /locus_tag="M164_0649"
FT   CDS_pept        complement(588125..589045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0649"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41268"
FT                   /db_xref="GOA:C4KES1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES1"
FT                   /protein_id="ACR41268.1"
FT   gene            589098..590180
FT                   /locus_tag="M164_0650"
FT   CDS_pept        589098..590180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0650"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41269"
FT                   /db_xref="GOA:C4KES2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES2"
FT                   /protein_id="ACR41269.1"
FT   gene            590280..591422
FT                   /locus_tag="M164_0651"
FT   CDS_pept        590280..591422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0651"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41270"
FT                   /db_xref="GOA:C4KES3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES3"
FT                   /protein_id="ACR41270.1"
FT   gene            complement(591388..592890)
FT                   /locus_tag="M164_0652"
FT   CDS_pept        complement(591388..592890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0652"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41271"
FT                   /db_xref="GOA:C4KES4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES4"
FT                   /protein_id="ACR41271.1"
FT   gene            complement(592893..593978)
FT                   /locus_tag="M164_0653"
FT   CDS_pept        complement(592893..593978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0653"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41272"
FT                   /db_xref="GOA:C4KES5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES5"
FT                   /protein_id="ACR41272.1"
FT   gene            complement(594051..594747)
FT                   /pseudo
FT                   /locus_tag="M164_0654"
FT   gene            595153..596085
FT                   /locus_tag="M164_0655"
FT   CDS_pept        595153..596085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0655"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41273"
FT                   /db_xref="GOA:C4KES6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KES6"
FT                   /protein_id="ACR41273.1"
FT   gene            596085..596747
FT                   /locus_tag="M164_0656"
FT   CDS_pept        596085..596747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41274"
FT                   /db_xref="GOA:C4KF58"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF58"
FT                   /protein_id="ACR41274.1"
FT   gene            596749..597228
FT                   /locus_tag="M164_0657"
FT   CDS_pept        596749..597228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41275"
FT                   /db_xref="GOA:C4KF59"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF59"
FT                   /protein_id="ACR41275.1"
FT   gene            597225..597467
FT                   /locus_tag="M164_0658"
FT   CDS_pept        597225..597467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41276"
FT                   /db_xref="GOA:C4KF60"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF60"
FT                   /protein_id="ACR41276.1"
FT   gene            597479..599146
FT                   /locus_tag="M164_0659"
FT   CDS_pept        597479..599146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41277"
FT                   /db_xref="GOA:C4KF61"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF61"
FT                   /protein_id="ACR41277.1"
FT   gene            complement(599117..600232)
FT                   /locus_tag="M164_0660"
FT   CDS_pept        complement(599117..600232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0660"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41278"
FT                   /db_xref="GOA:C4KF62"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF62"
FT                   /protein_id="ACR41278.1"
FT   gene            600289..601446
FT                   /locus_tag="M164_0661"
FT   CDS_pept        600289..601446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0661"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41279"
FT                   /db_xref="GOA:C4KF63"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF63"
FT                   /protein_id="ACR41279.1"
FT   gene            complement(601400..602602)
FT                   /locus_tag="M164_0662"
FT   CDS_pept        complement(601400..602602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0662"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41280"
FT                   /db_xref="GOA:C4KF64"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF64"
FT                   /protein_id="ACR41280.1"
FT                   T"
FT   gene            603578..605371
FT                   /locus_tag="M164_0663"
FT   CDS_pept        603578..605371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41281"
FT                   /db_xref="GOA:C4KF65"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF65"
FT                   /protein_id="ACR41281.1"
FT   gene            605361..606014
FT                   /locus_tag="M164_0664"
FT   CDS_pept        605361..606014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41282"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF66"
FT                   /protein_id="ACR41282.1"
FT   gene            606456..608195
FT                   /locus_tag="M164_0665"
FT   CDS_pept        606456..608195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41283"
FT                   /db_xref="GOA:C4KF67"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF67"
FT                   /protein_id="ACR41283.1"
FT                   VNK"
FT   sig_peptide     606456..606524
FT                   /locus_tag="M164_0665"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.770 at
FT                   residue 23"
FT   gene            608506..609360
FT                   /locus_tag="M164_0666"
FT   CDS_pept        608506..609360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0666"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41284"
FT                   /db_xref="GOA:C4KF68"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF68"
FT                   /protein_id="ACR41284.1"
FT                   YSL"
FT   gene            609643..610566
FT                   /locus_tag="M164_0667"
FT   CDS_pept        609643..610566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0667"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41285"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF69"
FT                   /protein_id="ACR41285.1"
FT   gene            610563..611777
FT                   /locus_tag="M164_0668"
FT   CDS_pept        610563..611777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0668"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41286"
FT                   /db_xref="GOA:C4KF70"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF70"
FT                   /protein_id="ACR41286.1"
FT                   AIGVS"
FT   sig_peptide     610563..610625
FT                   /locus_tag="M164_0668"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.965 at
FT                   residue 21"
FT   gene            611777..612529
FT                   /locus_tag="M164_0669"
FT   CDS_pept        611777..612529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0669"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41287"
FT                   /db_xref="GOA:C4KF71"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF71"
FT                   /protein_id="ACR41287.1"
FT   gene            complement(612620..612916)
FT                   /locus_tag="M164_0670"
FT   CDS_pept        complement(612620..612916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41288"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF72"
FT                   /protein_id="ACR41288.1"
FT   gene            complement(613230..614228)
FT                   /locus_tag="M164_0671"
FT   CDS_pept        complement(613230..614228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0671"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41289"
FT                   /db_xref="GOA:C4KF73"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF73"
FT                   /protein_id="ACR41289.1"
FT   gene            615449..616372
FT                   /locus_tag="M164_0672"
FT   CDS_pept        615449..616372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0672"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41290"
FT                   /db_xref="GOA:C4KF74"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF74"
FT                   /protein_id="ACR41290.1"
FT   gene            complement(616560..617621)
FT                   /locus_tag="M164_0673"
FT   CDS_pept        complement(616560..617621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF75"
FT                   /protein_id="ACR41291.1"
FT                   LYNNSIKCSYQHV"
FT   gene            617893..619017
FT                   /locus_tag="M164_0674"
FT   CDS_pept        617893..619017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41292"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF76"
FT                   /protein_id="ACR41292.1"
FT   gene            619538..620296
FT                   /locus_tag="M164_0675"
FT   CDS_pept        619538..620296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41293"
FT                   /db_xref="GOA:C4KF77"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF77"
FT                   /protein_id="ACR41293.1"
FT   sig_peptide     619538..619660
FT                   /locus_tag="M164_0675"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.499 at
FT                   residue 41"
FT   gene            620346..621413
FT                   /locus_tag="M164_0676"
FT   CDS_pept        620346..621413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0676"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41294"
FT                   /db_xref="GOA:C4KF78"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF78"
FT                   /protein_id="ACR41294.1"
FT                   LLSFIIIIVMNGDKV"
FT   sig_peptide     620346..620465
FT                   /locus_tag="M164_0676"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.810 at
FT                   residue 40"
FT   gene            621410..621814
FT                   /locus_tag="M164_0677"
FT   CDS_pept        621410..621814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41295"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF79"
FT                   /protein_id="ACR41295.1"
FT   gene            621820..622707
FT                   /locus_tag="M164_0678"
FT   CDS_pept        621820..622707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41296"
FT                   /db_xref="GOA:C4KF80"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF80"
FT                   /protein_id="ACR41296.1"
FT                   DNDVVYVYYNKKSN"
FT   gene            623578..623880
FT                   /locus_tag="M164_0679"
FT   CDS_pept        623578..623880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF81"
FT                   /protein_id="ACR41297.1"
FT   gene            623905..624528
FT                   /locus_tag="M164_0680"
FT   CDS_pept        623905..624528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41298"
FT                   /db_xref="GOA:C4KF82"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF82"
FT                   /protein_id="ACR41298.1"
FT   gene            complement(625122..625799)
FT                   /locus_tag="M164_0681"
FT   CDS_pept        complement(625122..625799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41299"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF83"
FT                   /protein_id="ACR41299.1"
FT                   KWK"
FT   gene            complement(626281..627042)
FT                   /locus_tag="M164_0682"
FT   CDS_pept        complement(626281..627042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41300"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF84"
FT                   /protein_id="ACR41300.1"
FT   gene            complement(628585..629898)
FT                   /locus_tag="M164_0683"
FT   CDS_pept        complement(628585..629898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0683"
FT                   /product="isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41301"
FT                   /db_xref="GOA:C4KF85"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF85"
FT                   /protein_id="ACR41301.1"
FT   gene            complement(630355..632835)
FT                   /locus_tag="M164_0684"
FT   CDS_pept        complement(630355..632835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0684"
FT                   /product="malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41302"
FT                   /db_xref="GOA:C4KF86"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF86"
FT                   /protein_id="ACR41302.1"
FT                   WVLELYDYVYDNYW"
FT   gene            complement(633089..633415)
FT                   /pseudo
FT                   /locus_tag="M164_0685"
FT   gene            633552..634841
FT                   /locus_tag="M164_0686"
FT   CDS_pept        633552..634841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0686"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41303"
FT                   /db_xref="GOA:C4KF87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF87"
FT                   /protein_id="ACR41303.1"
FT   gene            complement(634848..636482)
FT                   /locus_tag="M164_0687"
FT   CDS_pept        complement(634848..636482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0687"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41304"
FT                   /db_xref="GOA:C4KF88"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF88"
FT                   /protein_id="ACR41304.1"
FT   gene            636583..637698
FT                   /locus_tag="M164_0688"
FT   CDS_pept        636583..637698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0688"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41305"
FT                   /db_xref="GOA:C4KF89"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF89"
FT                   /protein_id="ACR41305.1"
FT   gene            complement(638325..638498)
FT                   /locus_tag="M164_0689"
FT   CDS_pept        complement(638325..638498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41306"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF90"
FT                   /protein_id="ACR41306.1"
FT                   IMIEDKMSELKV"
FT   gene            complement(638697..639023)
FT                   /locus_tag="M164_0690"
FT   CDS_pept        complement(638697..639023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0690"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41307"
FT                   /db_xref="GOA:C4KF91"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF91"
FT                   /protein_id="ACR41307.1"
FT                   FIQI"
FT   gene            complement(639078..639644)
FT                   /locus_tag="M164_0691"
FT   CDS_pept        complement(639078..639644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0691"
FT                   /product="Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41308"
FT                   /db_xref="GOA:C4KF92"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF92"
FT                   /protein_id="ACR41308.1"
FT   gene            640026..641147
FT                   /locus_tag="M164_0692"
FT   CDS_pept        640026..641147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0692"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41309"
FT                   /db_xref="GOA:C4KF93"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF93"
FT                   /protein_id="ACR41309.1"
FT   gene            complement(641763..642860)
FT                   /locus_tag="M164_0693"
FT   CDS_pept        complement(641763..642860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0693"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41310"
FT                   /db_xref="GOA:C4KF94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF94"
FT                   /protein_id="ACR41310.1"
FT   gene            642905..643171
FT                   /locus_tag="M164_2832"
FT   CDS_pept        642905..643171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2832"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41311"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF95"
FT                   /protein_id="ACR41311.1"
FT   gene            643324..643899
FT                   /pseudo
FT                   /locus_tag="M164_0694"
FT   gene            643930..644673
FT                   /locus_tag="M164_0695"
FT   CDS_pept        643930..644673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0695"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41312"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF96"
FT                   /protein_id="ACR41312.1"
FT   gene            645016..645477
FT                   /locus_tag="M164_0696"
FT   CDS_pept        645016..645477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0696"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41313"
FT                   /db_xref="GOA:C4KF97"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF97"
FT                   /protein_id="ACR41313.1"
FT   gene            complement(645470..647293)
FT                   /locus_tag="M164_0697"
FT   CDS_pept        complement(645470..647293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0697"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41314"
FT                   /db_xref="GOA:C4KF98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF98"
FT                   /protein_id="ACR41314.1"
FT   gene            complement(647283..647867)
FT                   /locus_tag="M164_0698"
FT   CDS_pept        complement(647283..647867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0698"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41315"
FT                   /db_xref="GOA:C4KF99"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF99"
FT                   /protein_id="ACR41315.1"
FT   gene            complement(647855..649693)
FT                   /locus_tag="M164_0699"
FT   CDS_pept        complement(647855..649693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0699"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41316"
FT                   /db_xref="GOA:C4KFA0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA0"
FT                   /protein_id="ACR41316.1"
FT   sig_peptide     complement(649604..649693)
FT                   /locus_tag="M164_0699"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.525 at
FT                   residue 30"
FT   gene            650024..650206
FT                   /locus_tag="M164_0700"
FT   CDS_pept        650024..650206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA1"
FT                   /protein_id="ACR41317.1"
FT                   GITKGENLVMIKLRR"
FT   gene            650483..650638
FT                   /locus_tag="M164_0701"
FT   CDS_pept        650483..650638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41318"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA2"
FT                   /protein_id="ACR41318.1"
FT                   MIEMKV"
FT   gene            650960..651169
FT                   /locus_tag="M164_0702"
FT   CDS_pept        650960..651169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41319"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA3"
FT                   /protein_id="ACR41319.1"
FT   gene            complement(651156..651590)
FT                   /locus_tag="M164_0703"
FT   CDS_pept        complement(651156..651590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0703"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41320"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA4"
FT                   /protein_id="ACR41320.1"
FT   gene            complement(651591..652088)
FT                   /locus_tag="M164_0704"
FT   CDS_pept        complement(651591..652088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0704"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41321"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA5"
FT                   /protein_id="ACR41321.1"
FT                   VI"
FT   gene            complement(652100..653278)
FT                   /locus_tag="M164_0705"
FT   CDS_pept        complement(652100..653278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0705"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41322"
FT                   /db_xref="GOA:C4KFA6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA6"
FT                   /protein_id="ACR41322.1"
FT   gene            complement(653275..654408)
FT                   /locus_tag="M164_0706"
FT   CDS_pept        complement(653275..654408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0706"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41323"
FT                   /db_xref="GOA:C4KFA7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA7"
FT                   /protein_id="ACR41323.1"
FT   gene            complement(654484..655599)
FT                   /locus_tag="M164_0707"
FT   CDS_pept        complement(654484..655599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0707"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41324"
FT                   /db_xref="GOA:C4KFA8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA8"
FT                   /protein_id="ACR41324.1"
FT   gene            655700..657568
FT                   /locus_tag="M164_0708"
FT   CDS_pept        655700..657568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0708"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41325"
FT                   /db_xref="GOA:C4KFA9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA9"
FT                   /protein_id="ACR41325.1"
FT   gene            complement(657560..658192)
FT                   /locus_tag="M164_0709"
FT   CDS_pept        complement(657560..658192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0709"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41326"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB0"
FT                   /protein_id="ACR41326.1"
FT   gene            658324..659802
FT                   /locus_tag="M164_0710"
FT   CDS_pept        658324..659802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0710"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41327"
FT                   /db_xref="GOA:C4KFB1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB1"
FT                   /protein_id="ACR41327.1"
FT   gene            659858..660325
FT                   /locus_tag="M164_0711"
FT   CDS_pept        659858..660325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0711"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41328"
FT                   /db_xref="GOA:C4KFB2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB2"
FT                   /protein_id="ACR41328.1"
FT   gene            660381..661328
FT                   /locus_tag="M164_0712"
FT   CDS_pept        660381..661328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0712"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41329"
FT                   /db_xref="GOA:C4KFB3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR011981"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB3"
FT                   /protein_id="ACR41329.1"
FT   gene            661325..662800
FT                   /locus_tag="M164_0713"
FT   CDS_pept        661325..662800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0713"
FT                   /product="4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41330"
FT                   /db_xref="GOA:C4KFB4"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB4"
FT                   /protein_id="ACR41330.1"
FT   gene            662852..663625
FT                   /locus_tag="M164_0714"
FT   CDS_pept        662852..663625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0714"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41331"
FT                   /db_xref="GOA:C4KFB5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB5"
FT                   /protein_id="ACR41331.1"
FT   gene            663694..663921
FT                   /locus_tag="M164_0715"
FT   CDS_pept        663694..663921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0715"
FT                   /product="DNA-directed RNA polymerase, subunit M (RpoM-2)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41332"
FT                   /db_xref="GOA:C4KFB6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB6"
FT                   /protein_id="ACR41332.1"
FT   gene            complement(663918..664325)
FT                   /locus_tag="M164_0716"
FT   CDS_pept        complement(663918..664325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0716"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41333"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB7"
FT                   /protein_id="ACR41333.1"
FT   gene            664390..664884
FT                   /locus_tag="M164_0717"
FT   CDS_pept        664390..664884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41334"
FT                   /db_xref="GOA:C4KFB8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB8"
FT                   /protein_id="ACR41334.1"
FT                   K"
FT   gene            complement(664894..665244)
FT                   /locus_tag="M164_0718"
FT   CDS_pept        complement(664894..665244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41335"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB9"
FT                   /protein_id="ACR41335.1"
FT                   KEELKELSAFRT"
FT   gene            665498..666541
FT                   /locus_tag="M164_0719"
FT   CDS_pept        665498..666541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0719"
FT                   /product="transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41336"
FT                   /db_xref="GOA:C4KFC0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025471"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC0"
FT                   /protein_id="ACR41336.1"
FT                   TGLFLRR"
FT   gene            666950..667138
FT                   /locus_tag="M164_0720"
FT   CDS_pept        666950..667138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41337"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC1"
FT                   /protein_id="ACR41337.1"
FT                   KYLHSIMNEHKMIEMKV"
FT   gene            667263..667499
FT                   /locus_tag="M164_0721"
FT   CDS_pept        667263..667499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41338"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC2"
FT                   /protein_id="ACR41338.1"
FT   gene            667496..667915
FT                   /locus_tag="M164_0722"
FT   CDS_pept        667496..667915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0722"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41339"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC3"
FT                   /protein_id="ACR41339.1"
FT   gene            668300..668449
FT                   /locus_tag="M164_0723"
FT   CDS_pept        668300..668449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41340"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC4"
FT                   /protein_id="ACR41340.1"
FT                   QHNL"
FT   gene            668838..670256
FT                   /locus_tag="M164_0724"
FT   CDS_pept        668838..670256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0724"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41341"
FT                   /db_xref="GOA:C4KFC5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC5"
FT                   /protein_id="ACR41341.1"
FT                   LFTRNYVIKTGQHA"
FT   gene            670374..670676
FT                   /locus_tag="M164_0725"
FT   CDS_pept        670374..670676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41342"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC6"
FT                   /protein_id="ACR41342.1"
FT   gene            671057..671488
FT                   /locus_tag="M164_0726"
FT   CDS_pept        671057..671488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0726"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41343"
FT                   /db_xref="GOA:C4KFC7"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC7"
FT                   /protein_id="ACR41343.1"
FT   gene            complement(671475..671660)
FT                   /locus_tag="M164_0727"
FT   CDS_pept        complement(671475..671660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41344"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC8"
FT                   /protein_id="ACR41344.1"
FT                   VNGEVLYVSKRDSNKD"
FT   gene            complement(672074..674704)
FT                   /locus_tag="M164_0728"
FT   CDS_pept        complement(672074..674704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0728"
FT                   /product="Thermopsin"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41345"
FT                   /db_xref="GOA:C4KFC9"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC9"
FT                   /protein_id="ACR41345.1"
FT                   ISKRK"
FT   sig_peptide     complement(674621..674704)
FT                   /locus_tag="M164_0728"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            complement(674986..676245)
FT                   /locus_tag="M164_0729"
FT   CDS_pept        complement(674986..676245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0729"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41346"
FT                   /db_xref="GOA:C4KFD0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD0"
FT                   /protein_id="ACR41346.1"
FT   gene            complement(676556..678406)
FT                   /locus_tag="M164_0730"
FT   CDS_pept        complement(676556..678406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0730"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41347"
FT                   /db_xref="GOA:C4KFD1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD1"
FT                   /protein_id="ACR41347.1"
FT   sig_peptide     complement(678272..678406)
FT                   /locus_tag="M164_0730"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.553 at
FT                   residue 45"
FT   gene            678802..680280
FT                   /locus_tag="M164_0731"
FT   CDS_pept        678802..680280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0731"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41348"
FT                   /db_xref="GOA:C4KFD2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD2"
FT                   /protein_id="ACR41348.1"
FT   gene            complement(680285..681781)
FT                   /locus_tag="M164_0732"
FT   CDS_pept        complement(680285..681781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0732"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41349"
FT                   /db_xref="GOA:C4KFD3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD3"
FT                   /protein_id="ACR41349.1"
FT   gene            complement(681828..683054)
FT                   /locus_tag="M164_0733"
FT   CDS_pept        complement(681828..683054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0733"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41350"
FT                   /db_xref="GOA:C4KFD4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD4"
FT                   /protein_id="ACR41350.1"
FT                   TVENKSIKG"
FT   gene            complement(683064..684347)
FT                   /locus_tag="M164_0734"
FT   CDS_pept        complement(683064..684347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0734"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41351"
FT                   /db_xref="GOA:C4KFD5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD5"
FT                   /protein_id="ACR41351.1"
FT   gene            684694..685566
FT                   /locus_tag="M164_0735"
FT   CDS_pept        684694..685566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0735"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41352"
FT                   /db_xref="GOA:C4KFD6"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD6"
FT                   /protein_id="ACR41352.1"
FT                   RLRFKKVTL"
FT   gene            complement(685569..687233)
FT                   /locus_tag="M164_0736"
FT   CDS_pept        complement(685569..687233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0736"
FT                   /product="Thermopsin"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:M164_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41353"
FT                   /db_xref="GOA:C4KFD7"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD7"
FT                   /protein_id="ACR41353.1"
FT   sig_peptide     complement(687147..687233)
FT                   /locus_tag="M164_0736"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.607 at
FT                   residue 29"
FT   gene            complement(687271..688353)
FT                   /locus_tag="M164_0737"
FT   CDS_pept        complement(687271..688353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0737"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41354"
FT                   /db_xref="GOA:C4KFD8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD8"
FT                   /protein_id="ACR41354.1"
FT   gene            688421..689581
FT                   /locus_tag="M164_0738"
FT   CDS_pept        688421..689581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0738"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41355"
FT                   /db_xref="GOA:C4KFD9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD9"
FT                   /protein_id="ACR41355.1"
FT   sig_peptide     688421..688495
FT                   /locus_tag="M164_0738"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            689556..690134
FT                   /locus_tag="M164_0739"
FT   CDS_pept        689556..690134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41356"
FT                   /db_xref="GOA:C4KFE0"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE0"
FT                   /protein_id="ACR41356.1"
FT   gene            690415..690540
FT                   /pseudo
FT                   /locus_tag="M164_2797"
FT   gene            complement(690639..691604)
FT                   /locus_tag="M164_0740"
FT   CDS_pept        complement(690639..691604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0740"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41357"
FT                   /db_xref="GOA:C4KFE1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE1"
FT                   /protein_id="ACR41357.1"
FT   gene            complement(691588..693180)
FT                   /locus_tag="M164_0741"
FT   CDS_pept        complement(691588..693180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0741"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41358"
FT                   /db_xref="GOA:C4KFE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE2"
FT                   /protein_id="ACR41358.1"
FT                   YELGGLIKNEHFS"
FT   gene            complement(693177..693902)
FT                   /locus_tag="M164_0742"
FT   CDS_pept        complement(693177..693902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0742"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41359"
FT                   /db_xref="GOA:C4KFE3"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE3"
FT                   /protein_id="ACR41359.1"
FT   gene            complement(693992..694630)
FT                   /locus_tag="M164_0743"
FT   CDS_pept        complement(693992..694630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0743"
FT                   /product="HAD-superfamily hydrolase, subfamily IA,
FT                   variant1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41360"
FT                   /db_xref="GOA:C4KFE4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE4"
FT                   /protein_id="ACR41360.1"
FT   gene            694711..695280
FT                   /locus_tag="M164_0744"
FT   CDS_pept        694711..695280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0744"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41361"
FT                   /db_xref="GOA:C4KFE5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE5"
FT                   /protein_id="ACR41361.1"
FT   gene            complement(695374..695904)
FT                   /locus_tag="M164_0745"
FT   CDS_pept        complement(695374..695904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0745"
FT                   /product="Protein of unknown function DUF1286"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41362"
FT                   /db_xref="GOA:C4KFE6"
FT                   /db_xref="InterPro:IPR009705"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE6"
FT                   /protein_id="ACR41362.1"
FT                   IIAGAVMIYLAYL"
FT   gene            complement(695901..696119)
FT                   /locus_tag="M164_0746"
FT   CDS_pept        complement(695901..696119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0746"
FT                   /product="zinc finger SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41363"
FT                   /db_xref="GOA:C4KFE7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE7"
FT                   /protein_id="ACR41363.1"
FT   gene            696363..696467
FT                   /locus_tag="M164_2798"
FT   CDS_pept        696363..696467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2798"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41364"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE8"
FT                   /protein_id="ACR41364.1"
FT   gene            696677..696871
FT                   /locus_tag="M164_0747"
FT   CDS_pept        696677..696871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0747"
FT                   /product="DNA-binding 7 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41365"
FT                   /db_xref="GOA:C4KFE9"
FT                   /db_xref="InterPro:IPR003212"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE9"
FT                   /protein_id="ACR41365.1"
FT   gene            697191..698492
FT                   /locus_tag="M164_0748"
FT   CDS_pept        697191..698492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0748"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41366"
FT                   /db_xref="GOA:C4KFF0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF0"
FT                   /protein_id="ACR41366.1"
FT   gene            698632..698898
FT                   /locus_tag="M164_0749"
FT   CDS_pept        698632..698898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41367"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF1"
FT                   /protein_id="ACR41367.1"
FT   gene            complement(698895..699125)
FT                   /locus_tag="M164_0750"
FT   CDS_pept        complement(698895..699125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0750"
FT                   /product="plasmid regulator"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41368"
FT                   /db_xref="InterPro:IPR008848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF2"
FT                   /protein_id="ACR41368.1"
FT   gene            complement(699545..700282)
FT                   /locus_tag="M164_0751"
FT   CDS_pept        complement(699545..700282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41369"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF3"
FT                   /protein_id="ACR41369.1"
FT   gene            complement(701067..703058)
FT                   /locus_tag="M164_0752"
FT   CDS_pept        complement(701067..703058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41370"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF4"
FT                   /protein_id="ACR41370.1"
FT   gene            complement(703237..703401)
FT                   /locus_tag="M164_0753"
FT   CDS_pept        complement(703237..703401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0753"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41371"
FT                   /db_xref="GOA:C4KFF5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF5"
FT                   /protein_id="ACR41371.1"
FT                   AKDMGIEVG"
FT   gene            complement(703513..703776)
FT                   /locus_tag="M164_0754"
FT   CDS_pept        complement(703513..703776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41372"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF6"
FT                   /protein_id="ACR41372.1"