(data stored in ACNUC7421 zone)

EMBL: CP001402.PE1

CP001402.PE1         Location/Qualifiers
FT   CDS_pept        471..767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40637"
FT                   /db_xref="GOA:C4KJB7"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB7"
FT                   /protein_id="ACR40637.1"
FT                   /translation="MVIRRMFIKSTLAVSFSISYLLYIIAKISFGSGKLAFIIALLQLY
FT                   PYFLIDYLPTVQVVSLFFQSLLLLLFAIFILLITYMLFLFYKLYKMVKTSILK"
     atggtaatca gacgtatgtt tataaagtct accttagccg tctctttttc aatatcgtat        60
     ttattgtata ttattgctaa gatatctttc ggatctggta aactcgcctt tattatagca       120
     ttgttacaat tatatcctta tttcctaatc gattatttgc ctacagtaca agttgtttcg       180
     ttgttcttcc aatctctttt attacttctt ttcgctattt tcattttatt gattacttac       240
     atgttatttt tattctacaa attatacaaa atggtaaaaa cttcaatttt gaagtaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page