(data stored in ACNUC7421 zone)

EMBL: CP001402.PE102

CP001402.PE102       Location/Qualifiers
FT   CDS_pept        complement(89121..90788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0102"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40738"
FT                   /db_xref="GOA:C4KJL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL8"
FT                   /protein_id="ACR40738.1"
FT                   /translation="MRRGVKSNEVRFVLAKNGILVSTIIPLLGYIMYGIALGSLSSIGY
FT                   STLAGILYTFTLYSPFIFFPSLLPLSAISYFLASIFLYKAYKYKTLRKYGIIAISLSVS
FT                   YIVLYVYNLFFVELIPKFLMSWVLIGFYEIGNTIQLLAWRVSLRTVLIKVYGLPNNLKW
FT                   KINIEGQKYTFSDSQAKVKVNKEKPSFYVDSILEGYNTYMPKPNSGIISSNLLEIYFTK
FT                   ISKIPDISNWDPKLWIGNKINEYEVIDIIAIGGSSYVLKVKRGNMLYAMKIPKISKSTP
FT                   GQTRISASNIIFDLSREFINLQEIGYKTQNAVQLFAISEIDISNIMKIEKGESYLYLTR
FT                   PPYIIIELMEGGNALQLLNISRSKDWYRIVGILIRDVAKALDIIHSSGYVHLDVKPQNI
FT                   YFSKFPGSKEKEILSNLTSGKVVVKLGDLGSTSRIGESVAEFTEFYCPIDQIEAAMLKN
FT                   KGALPSMDVFALGATAYKLLFDSYVYPKEYYELIEKAIEEFQMGRGNYLNNLKLARQYA
FT                   ILPKINNMPSWLVNLLYDMLLQRTNARTIYTTIEYNLR"
     atgagacgag gagtaaaaag taatgaagtg agattcgttc tcgctaaaaa tggtatattg        60
     gtatcaacta tcattcccct tcttggatac ataatgtatg ggatagcctt aggctccctt       120
     tcttcaattg gatattccac attagctgga atactctata catttacatt atactctcct       180
     ttcatatttt tcccttctct actaccactt tccgccatat cttattttct agcttccata       240
     tttctttata aggcttataa atacaagact ctaagaaaat atggaattat agctatttca       300
     ctatcagtat cttacatcgt attgtatgta tataatctct tttttgtgga attaattcca       360
     aaatttctaa tgagttgggt tttgatagga ttttatgaga taggcaacac tatacaatta       420
     ttagcgtgga gagtaagtct aaggactgtc ttgataaaag tttatggctt gccaaataac       480
     ctaaagtgga aaattaatat tgaaggacaa aaatacactt tttctgactc tcaagcaaaa       540
     gtaaaagtta acaaggaaaa acctagcttc tatgttgata gtattttaga aggatataat       600
     acttatatgc caaagcctaa tagtggaatt ataagtagta acttattgga aatttatttc       660
     acaaaaatta gcaaaatacc agatattagc aactgggatc caaagttatg gataggaaat       720
     aagataaatg aatacgaagt tattgatata atagccatag gtggtagctc atacgtgtta       780
     aaagtcaaga ggggaaatat gttatatgcg atgaaaattc cgaagattag taagagcacc       840
     ccaggacaaa ctaggattag tgctagtaat ataatatttg atcttagtag ggaatttatc       900
     aatttacagg agattggata taaaactcaa aatgcagtac agttatttgc aataagtgaa       960
     atagatatta gcaatataat gaaaattgag aaaggggaga gctatctcta cctaactagg      1020
     ccaccttata taataataga attaatggag ggcggtaatg ctttacagct tttaaacata      1080
     agtagaagta aagattggta tagaattgtt ggaatattaa ttagagatgt agcaaaggcg      1140
     ttagatatta tccattcatc tggttatgtt catttagatg taaaaccaca aaatatctat      1200
     ttcagtaaat tccctggtag taaagagaaa gaaatcctca gtaatttaac tagtggtaaa      1260
     gtggtggtta aattaggaga tttgggctca accagtagaa taggcgaaag tgtagctgaa      1320
     tttacggaat tctattgccc tatagatcaa atagaagctg ctatgctaaa gaataaaggg      1380
     gcattaccta gtatggacgt atttgccttg ggcgcaacag cctataagct tctattcgat      1440
     agttacgtat atcctaaaga atactatgag ttaatagaaa aggcgataga agaatttcaa      1500
     atgggtagag gaaattactt gaataatcta aaactcgcta ggcagtacgc catattacct      1560
     aaaataaata atatgccatc atggttagtt aacctcttgt atgacatgct attacaaaga      1620
     actaacgcta gaacaatcta tactactata gaatataatt tacgttaa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page