(data stored in ACNUC7421 zone)

EMBL: CP001402.PE103

CP001402.PE103       Location/Qualifiers
FT   CDS_pept        91026..92051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0103"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40739"
FT                   /db_xref="GOA:C4KJL9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJL9"
FT                   /protein_id="ACR40739.1"
FT                   /translation="MERKQVFVRETSGLIKQVSLTDAVMLNLANMSIGIALFQSISPYI
FT                   TQGGVLWMASLIGMFLALPQALVYTIFNRKVGRTGGDYVWISRNLGGIIGTIFAVAYLL
FT                   EATAFYAIISFFSASSINSALLTIGYLNHQNTLIYVTENVIVNPYATPTLQQRLIFYGI
FT                   SALAFVIIVLINILHSKWGYKLVTSLGTFSILTIILAMIIIAINAKHFDSSVIPLLKDF
FT                   NVTVSSNLPKTILPYSISLPATLSLLPLFSLYTYPWMNAGPAVSSEFRGDKVSKFNVFF
FT                   SLLITGILVTLGFLEMDVVGGYYFNLNAYPSAIYNFWTVAMALSLNPMSVDNNFVHLKF
FT                   G"
     atggaaagaa agcaggtctt tgtgagagaa acttctggtc tcataaagca agtatccctt        60
     actgatgcgg taatgctcaa tttagctaac atgtcaatag gcatagcctt attccaatcc       120
     atatctccct atataacaca aggtggagtg ctatggatgg catcattgat aggtatgttc       180
     ttagcgttac ctcaagcgct agtttacacc atattcaaca gaaaggttgg aagaacgggt       240
     ggggattacg tatggatatc aaggaattta ggcggaataa taggtacaat tttcgcagta       300
     gcatatcttt tagaagcaac tgcgttttac gctatcatct cattcttctc ggcgtcatca       360
     attaactctg cgttgctgac aattggctat cttaaccatc aaaatacgtt aatttacgtt       420
     actgaaaatg tgatcgttaa tccttatgcc actccaacgc ttcaacaaag gctaatattc       480
     tatggaattt cagcacttgc gtttgtaata atagtgctta taaatattct acactccaaa       540
     tgggggtata agttagttac aagtttagga acgttctcaa ttcttactat aatactcgcg       600
     atgataataa ttgcaattaa cgctaagcat tttgattctt cagtcatacc tttacttaag       660
     gactttaacg taactgtatc atcaaacctg cctaaaacta tattacctta ttcaatatca       720
     ttaccggcta cactttctct cttacctctc ttttcactgt acacatatcc ttggatgaat       780
     gcaggtcctg cagtatcttc agagtttagg ggagataagg tctccaaatt caatgtgttc       840
     ttctcgctat taattactgg aattttagta acattaggat ttctggaaat ggatgttgtt       900
     ggtgggtatt actttaattt aaacgcctat ccatctgcga tttataactt ttggacagtg       960
     gctatggcgt tatccttaaa tccaatgagt gtggacaaca atttcgttca tttgaaattt      1020
     ggttaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page