(data stored in ACNUC7421 zone)

EMBL: CP001402.PE104

CP001402.PE104       Location/Qualifiers
FT   CDS_pept        complement(92341..93048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40740"
FT                   /db_xref="UniProtKB/TrEMBL:C4KG94"
FT                   /protein_id="ACR40740.1"
FT                   /translation="MGTMWKVPVLTQVILVLMEYINLSPRFYSKETVASALTNYVSGLS
FT                   SWRAVLPHSTLLYYHRRLSYVKYAVPLSGVYAIDEAKVRLTNGQYYYVWIVRDVKTKAI
FT                   PFFMITSVRSGVHVLVVLANMKRAEEVTRRIFKVRMDKVIYLHDGATAYNAFSWLNVEH
FT                   EKVMFNERDYAEQGFRSLKHRLASMDFHFPWNSNKFTLARWLSTFFLIYNILYTPTYLL
FT                   DKGVIINVNISNE"
     atgggaacta tgtggaaagt tcccgtgctc acccaagtta tattagtatt gatggagtat        60
     attaacctta gcccgaggtt ttactccaag gaaaccgtag cctctgcctt gactaactac       120
     gtttccggat tatcctcctg gagggcagtt ttaccccact ctactctgct ttactaccat       180
     aggaggttga gttatgttaa gtacgctgtg ccattgagcg gggtttacgc gattgacgag       240
     gctaaggtaa ggctaactaa tggtcagtat tattacgtgt ggatcgttag ggatgtcaaa       300
     accaaggcta tacctttctt catgattacc agcgttagga gtggagtaca cgtcttggtg       360
     gtcctagcaa atatgaagag ggctgaggaa gtaacaagga ggatatttaa agtaaggatg       420
     gacaaggtaa tttacttgca cgatggagca acagcttaca acgccttctc atggctaaac       480
     gtagaacatg agaaggtaat gttcaacgag agggattatg cagaacaagg gttcagaagc       540
     ttgaaacata ggcttgcatc aatggacttc cacttccctt ggaattctaa caagtttaca       600
     ctagctaggt ggttatcaac atttttccta atatataaca ttctttacac cccaacgtac       660
     ttgttagata agggggtgat aataaatgta aatatctcaa atgaatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page