(data stored in ACNUC7421 zone)

EMBL: CP001402.PE105

CP001402.PE105       Location/Qualifiers
FT   CDS_pept        93160..93735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0105"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40741"
FT                   /db_xref="GOA:C4KJM1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM1"
FT                   /protein_id="ACR40741.1"
FT                   /translation="MLSTLNPIIEWILGLGLILWNYFVLSYGVLVFSRYVFALSFDRVF
FT                   PEKLSQLNAHGSPVYAHLLDITLTLLFLLIPVFSIDAAISLYGASIVGMLYFLAVGISA
FT                   IIFGQKTKSRLMKIAGILTTIYFVYLTYEAATNPLFGFSTTSGVNIITLSFVLGSFVSG
FT                   IIIWSVTKYMNLKKGIDLSLTFKEIPPE"
     ttgttgtcca cactcaatcc aattatagaa tggatattgg gacttgggtt aatactctgg        60
     aattacttcg tcttatcata tggtgtctta gtattttcaa gatatgtatt tgccctatca       120
     tttgacagag tgtttcctga gaaattatcg caacttaacg cacatggatc tccagtttac       180
     gctcacctcc tagatataac cctaacgcta ttattcctct taattccagt attttcaata       240
     gatgctgcca tatcactata tggtgcttct atagttggaa tgttgtattt cttggcagta       300
     ggtatttcag ccataatatt tggacagaag actaaaagta gattaatgaa gattgcaggt       360
     atcttaacga cgatttattt cgtatatctg acctatgaag ctgcgacaaa tcccttgttc       420
     ggtttctcaa cgacgtctgg tgttaatatt atcactttgt catttgttct tgggtctttt       480
     gtatcgggca taataatctg gagtgtaact aagtacatga atttaaagaa aggaatagat       540
     ctatcattaa cttttaagga aattcctcca gagtag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page