(data stored in ACNUC7421 zone)

EMBL: CP001402.PE109

CP001402.PE109       Location/Qualifiers
FT   CDS_pept        complement(95267..96256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0109"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40745"
FT                   /db_xref="GOA:C4KJM5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJM5"
FT                   /protein_id="ACR40745.1"
FT                   /translation="MIENLWRGIAIISASEDGFKAGEIVKEKLKRFEIPVVHFKYKDAD
FT                   IETVWRCYDAIIFVMALEGATRIICKYAKSKTEDPAIICIDDKINYVIPLLGGHWGAND
FT                   IARDLSVILNSTPIITTAAELKGKLSVEKIANILVAKILNPENIVKINAVLLRDEYVCV
FT                   DGVDINVTFPENIRINSEECNYIVSLRNDKEYKDKIVVWLKPLKISIGVGSKKDVKIDE
FT                   IRDGIYKVLERLNLKRERIGIIASIREEVKKIADEINVKFRLVNEEEINNFTNPCLTPP
FT                   SKTLIEVGLKGVAEISALIAGGINSKLILRKIAISRNSTIAVATYEGE"
     atgatagaaa acttatggcg aggaattgcc ataatctcag cctctgaaga cggtttcaaa        60
     gcaggcgaaa tagttaagga gaagttaaaa agatttgaga tacccgtagt ccatttcaag       120
     tataaggacg cagatatcga aacagtatgg agatgttatg atgcgattat atttgtaatg       180
     gcactagaag gagccactag gattatttgc aaatacgcga agtctaagac cgaggatcct       240
     gcaataatat gtattgacga taaaataaat tacgttatac cccttcttgg tgggcattgg       300
     ggtgctaacg atatcgcaag agacttatct gtaattttaa actcaacacc gataataacc       360
     acagctgctg aattaaaagg caagttaagt gttgaaaaga tagcgaacat tttagttgct       420
     aaaatattaa atcccgaaaa tatagttaag ataaatgcag tcctattaag agatgagtat       480
     gtttgtgtgg atggagttga tattaacgtt acgttccccg aaaatataag gataaatagt       540
     gaggagtgca attacatcgt atcgttgagg aacgataagg agtataagga taagatagta       600
     gtatggctga aaccactaaa gatatcaata ggtgtagggt ctaaaaaaga cgtgaaaata       660
     gatgagatta gagatggaat atacaaggta ctagaaaggc ttaacttaaa aagagagaga       720
     attggcataa ttgcgtctat tcgagaagag gtcaagaaaa ttgctgatga aattaatgtt       780
     aaatttagat tagtaaacga ggaggagata aacaacttta caaatccatg ccttactcct       840
     cctagcaaaa ccctcattga agttggcttg aaaggagtag ctgaaatttc cgccctaata       900
     gctggtggaa ttaattcaaa attgatattg agaaaaatag ccataagtag aaattccact       960
     attgcagtag caacttatga gggtgagtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page