(data stored in ACNUC7421 zone)

EMBL: CP001402.PE116

CP001402.PE116       Location/Qualifiers
FT   CDS_pept        complement(102030..103064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0116"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40752"
FT                   /db_xref="GOA:C4KJN2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="InterPro:IPR023863"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN2"
FT                   /protein_id="ACR40752.1"
FT                   /translation="MSTLKPMIVGNVKRALLGLGVRKLPLIAGHKLLYTCNLRCRMCPF
FT                   WRRKDEKLLSLEEEVLMLKSLERAGVLFMGFEGGEPLLRRDLEQILEESYKRFYTSLVT
FT                   NGWLLKDRVKSISENLDYLFVSIDGIDEVHDKIRGISGAFERAVEGIKEARKYLPVAIS
FT                   FTITRENMDQVKDVIELAQKLNVKISIQVEYDYSTAEKLSPDKRRLYDTLRLIIELKKR
FT                   GYPIVESVDYFEAIVNSWYNKMPWKCKPWLTINIDPQGRIVLPCYVLNEYSGTDKAWEV
FT                   NIVKLWNTYPWEKYENCNACALACYLEPSLFSWSNGKMVKEKIIDNMASYLYNAILVKF
FT                   LLSR"
     atgtcaactt taaaacctat gatagtaggc aacgtgaaaa gggcacttct ggggcttgga        60
     gttagaaaat tacctctgat tgcagggcac aagttgttat atacgtgcaa cttaagatgc       120
     agaatgtgcc ctttttggag aaggaaagac gaaaaattac tatctttaga agaagaggtt       180
     ttaatgttga aatcattaga aagagcggga gttcttttca tggggtttga gggtggagaa       240
     ccgttactga gaagagattt agagcaaata ttagaggagt cttacaagag attctatact       300
     tcattagtta caaatggatg gctccttaaa gatagggtca agagtataag tgaaaatcta       360
     gattacttat ttgtatctat agatggaata gacgaagtac atgataaaat taggggaatt       420
     tcaggcgcct ttgaaagggc tgtagaaggt ataaaggagg caaggaagta cttaccagta       480
     gcgattagct ttacaataac tagagaaaat atggatcaag ttaaggatgt aattgagctt       540
     gcacaaaaac ttaatgttaa aattagtata caagttgagt acgactattc taccgctgag       600
     aaattaagtc cggataagag gagactttac gatacattaa ggctaataat tgagcttaag       660
     aagaggggct atcccatagt tgaatctgta gattactttg aggcaatagt taactcatgg       720
     tataataaga tgccatggaa atgcaaacct tggttgacca ttaatattga cccacaaggt       780
     agaatcgtac tcccttgcta cgtgctaaat gagtatagtg gaactgataa agcctgggag       840
     gttaatatag ttaaattatg gaatacttat ccttgggaga aatatgagaa ttgtaacgct       900
     tgtgctcttg cttgttattt agagccttca ctgtttagct ggtcaaatgg aaaaatggta       960
     aaagagaaaa taatagataa catggcaagc tatctttata acgctattct tgtcaaattt      1020
     ttattatcaa gataa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page