(data stored in ACNUC7421 zone)

EMBL: CP001402.PE117

CP001402.PE117       Location/Qualifiers
FT   CDS_pept        103058..103957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0117"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40753"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN3"
FT                   /protein_id="ACR40753.1"
FT                   /translation="MTYLINIQTHVLIFCEKLNITDFVSQVMPTVKLTKNITVMTGSPN
FT                   TLIYDNRVVIDLGGKNSSLDLNAEVQLATHGHADHIAGLLKKDAKIRYLPKEDYWSLTL
FT                   MGRRAMIYGCSSKDSEIFIFDYVKENLDSLNNEIRNSEIEVVKLPGHTPGHSGYIVHNV
FT                   LYAGDAFFGEKVLESFSVPFYTDFWAALESLDKVKELAKSVDNIVISHGPVYTNKNKMV
FT                   SILESNITYAQKLIGKILDLLSNSAFTVEEIVVKLKQDLTPANVLLNSVVVRSILLGLE
FT                   NIEYNITQKGLVFRRKVH"
     ttgacatatt tgattaatat acaaacgcat gtattaatct tttgcgaaaa gttaaatatc        60
     acagacttcg ttagtcaagt tatgccaact gtgaaactca caaagaacat tacggttatg       120
     actgggagtc caaatacgtt gatttacgat aatagagttg tgatagatct gggaggaaag       180
     aactcctccc tagatctaaa tgctgaagtt caattagcta ctcatggcca tgccgatcat       240
     atagctggtt tattgaagaa ggatgctaaa ataagatatc tccctaagga ggactattgg       300
     tcattaactc taatgggaag aagagcaatg atttatggat gtagttcgaa ggattccgaa       360
     atcttcatat ttgattacgt aaaagagaat ctcgattctt tgaataatga gattcgaaat       420
     tcagagattg aagtggtaaa attgccagga catacaccag gtcatagcgg ttatattgtt       480
     cataatgttc tatatgcggg agatgcgttt tttggtgaga aagtactaga gagtttctca       540
     gttccctttt atactgattt ctgggctgct ctagaatcgt tggataaagt taaagagttg       600
     gcaaagagtg ttgataacat agtaataagt catggtccag tttacactaa caagaataaa       660
     atggtctcga ttttagagag taatattact tatgctcaaa agttaatagg aaaaatccta       720
     gatctattgt caaacagtgc gtttacagtg gaggaaattg tagttaagtt aaagcaagat       780
     ttaacaccag ctaatgtgtt gctaaattcc gttgttgtga ggtcaatact cctagggtta       840
     gagaatatcg agtataatat aactcaaaaa ggtttagttt ttagaagaaa agttcattag       900
//

If you have problems or comments...

PBIL Back to PBIL home page