(data stored in ACNUC7421 zone)

EMBL: CP001402.PE118

CP001402.PE118       Location/Qualifiers
FT   CDS_pept        complement(104257..105678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0118"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40754"
FT                   /db_xref="GOA:C4KJN4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN4"
FT                   /protein_id="ACR40754.1"
FT                   /translation="MPRIFSIKNEVDSKYIFMLAFMLALFSSGVPPEIVILHLSREDTF
FT                   EPYTKVFKKIRNLVSGYRYKFSSAITYSIKNLNIRYLKEFLIRLSQAVTFGDDMIESLS
FT                   REIDFTLSEYNAYSARLIESMNNFLTIYATLNSSLTFLVADITILSLIYSGGTTLITQL
FT                   TILSLALLGNLTLVMYLLYRPENYIRYNVIDKLLLTLAISLSIIFSIIYTSYIVLMVTG
FT                   IVLLGVGLRYRIYENKINRIERHFLLFIRYFSRNYAIVSNLKESLMAVLRGDLGDVKPL
FT                   IKRSLNRLNFGINKEKIFRLIGDESGSVLVSMLSKVLYETISMGGNVMIIGEILSKIGD
FT                   SVLNIRSRKEQNGRAFETSIYALQTASAGVSAALISIVGMLNNIFSTQNVSTVFSFSEV
FT                   NIDMISRIFLIILLILSFTNGIAITLAYGKSLYVSLYFIGILIILSSISYHIVLILTGN
FT                   IFKELVSPSGLLQTT"
     atgccaagaa tatttagtat aaaaaatgaa gtagactcta aatatatttt tatgttagct        60
     tttatgcttg cgttattttc ctcgggggtg ccaccagaaa tcgttatatt gcatttaagt       120
     agggaggaca cctttgaacc atataccaaa gttttcaaaa aaataagaaa tttagtttct       180
     gggtatagat ataaattctc atctgcaata acctacagca taaagaacct caacattaga       240
     tacttgaaag aattcttaat aagattatca caagcagtaa cttttggtga tgacatgata       300
     gagtccttgt caagagaaat tgattttaca ttatctgaat acaatgctta ttctgctagg       360
     ttaatagaat caatgaataa ttttcttaca atctatgcta cattaaatag ctcccttacc       420
     tttttagtag ctgacattac aattttatca ttaatttata gtggaggaac tactctaata       480
     acacagctta ctatcttatc cttagcactt ctaggaaatt taacattagt tatgtatctc       540
     ttatatagac cagaaaatta cattaggtac aacgttatag ataaacttct tctgacatta       600
     gcaatatctc tttcaataat attttcaata atatatactt catatatagt tttaatggta       660
     actggtatag ttctattagg agttggtctt aggtatagaa tatatgaaaa taagattaat       720
     agaatagaga ggcatttctt actttttatt agatactttt cgagaaatta tgcgatagta       780
     agcaacttaa aagagtctct gatggcagta ctaagggggg atttaggaga cgtaaaacct       840
     ttaatcaaaa gatcgctaaa tagattaaac ttcggcatca ataaggaaaa aatatttaga       900
     ttgataggag atgaaagcgg aagcgtattg gtgagcatgt taagcaaagt actatatgaa       960
     acgataagta tgggaggaaa tgtcatgata attggagaga ttctaagtaa gataggtgat      1020
     tcggttctga acataagatc tagaaaagag caaaatggaa gagcttttga aacatcaata      1080
     tatgcactgc aaacagcttc agcaggggta tctgctgcat taatatcgat agttggtatg      1140
     ctaaataata tattttcaac ccagaacgta tctacagtat ttagtttctc tgaagttaat      1200
     attgatatga tatcacgaat atttctaatt atattattaa tattgagctt cactaatgga      1260
     attgcgatta cattggcata tggcaaatcg ctttatgtta gtctatattt tattggaata      1320
     ctgataatat taagctcaat aagctatcat atagttctca tattaaccgg aaacatattt      1380
     aaggagttgg tatcgccatc gggtttatta caaacaactt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page