(data stored in ACNUC7421 zone)

EMBL: CP001402.PE119

CP001402.PE119       Location/Qualifiers
FT   CDS_pept        complement(105662..107203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0119"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40755"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJN5"
FT                   /protein_id="ACR40755.1"
FT                   /translation="MSFIEDYLSRFPEKPVIIDDPNKLKGSKNYNAIYKVDKYIYIHVQ
FT                   STKAEDGYNQYTVIEPPRPKPKEIEEIEEKFAKAISNVEPPIAVEEKEILMRKALDKIL
FT                   SRIRISVPKEYAIYHFIRDKLYLSILEPLIRDPFIEDISIPGLGHIYIVHKVFGPMRTS
FT                   LLIENEEELDNLIISLSEKTYRPVSHNRPIIDASLPDGSRVNFVYGIDISRRGSNLTVR
FT                   KFSKIPISVTQLISFGTLSPLLAAYIWMMLDEGMNLFVCGETASGKTTTLNAITAFIPP
FT                   NLKIVTIEDTPELTVPHSNWVAEVTRETGGEGSVKLFDLLKAALRQRPNYILVGEIRDR
FT                   EGNVAFQAMQTGHSVMATFHAANIRTLVQRLTGYPIEVPKSYINNLNIALFQTALYDKK
FT                   GNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDPAEDKIIFAGRGASYLIENKVAIKRGI
FT                   ERKNIGILYDELNLRAEFLKILISKKIFNYFEVWNQILRTRQFGIEEEIRYAKNI"
     atgagcttca tagaagatta cttatctaga ttcccggaaa aaccagtaat tatcgatgac        60
     ccaaataaac tgaaaggtag taagaattat aatgcaattt ataaggtcga taaatatatt       120
     tacatccatg ttcagagtac aaaggcagaa gatggttata accaatatac agtgattgaa       180
     ccacctagac caaaacctaa agaaatagaa gaaatagaag agaaattcgc aaaagccatt       240
     agtaatgtgg aaccaccaat tgctgttgaa gaaaaggaga tacttatgcg gaaagcttta       300
     gataaaatac taagcaggat aagaatatcc gtaccaaagg aatacgcaat atatcatttt       360
     ataagagata aattgtattt aagcatatta gaaccgttaa ttagggatcc atttatcgag       420
     gatatatcga ttccaggctt aggtcacatt tacattgtgc ataaggtatt cggtcctatg       480
     agaacctcat tgttaatcga gaacgaagag gaacttgata atctaattat ttctttaagt       540
     gagaaaacat atagaccagt atctcataac agaccaataa ttgatgcaag cttaccagat       600
     ggatcaagag taaacttcgt ttatggaatt gatataagta gaagaggttc taatttgact       660
     gtaagaaaat tcagtaaaat accaattagt gtaactcaat tgatctcatt cggtaccttg       720
     tccccacttc tagcagcgta tatatggatg atgttagacg agggtatgaa cttgttcgta       780
     tgtggagaga ctgcatccgg aaaaacaact acacttaatg caattaccgc tttcattcct       840
     cctaatttaa aaatagtaac aatagaagat acaccggaac ttacggtacc tcattcaaat       900
     tgggtagcag aagtgactag agaaacaggc ggtgagggta gtgtaaagct attcgactta       960
     cttaaagccg ctttaaggca aagacctaat tatattctag tcggagaaat tagagataga      1020
     gaaggtaatg tagcattcca agcaatgcaa actggacatt cagttatggc tacctttcat      1080
     gcagcaaata taagaacact tgttcaaagg cttactggtt atcctataga agtacctaaa      1140
     agttatatta ataaccttaa catagcacta tttcagactg cattatatga taaaaagggc      1200
     aatttgataa gaagagtagt ggaagttgat gaaataatag atatagaccc tgttactaat      1260
     gacgtagtct atataccagc atttacatat gatcctgcag aagataagat aatttttgct      1320
     ggaagaggag cttcttatct tatagaaaat aaggttgcaa ttaaaagagg aatcgaacgt      1380
     aaaaatatag gaattcttta tgacgaatta aacttaagag ctgagtttct aaaaatactt      1440
     ataagtaaaa aaatttttaa ttattttgaa gtatggaatc aaatattaag aactagacaa      1500
     tttggtatag aagaggagat aagatatgcc aagaatattt ag                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page