(data stored in ACNUC7421 zone)

EMBL: CP001402.PE121

CP001402.PE121       Location/Qualifiers
FT   CDS_pept        complement(107892..108380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40757"
FT                   /db_xref="GOA:C4KK16"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK16"
FT                   /protein_id="ACR40757.1"
FT                   /translation="MGVSQVVAYVLLFFITISLGLIALGAYIKSQQFLLHAEDMRQNMD
FT                   LNQLNTRIFIKSVAINGYLLYMTITNNGSTVLYDFKDFAIIIKYYANVSNVSTLIISNY
FT                   NYSTSLGPYKWVSNTVLINPNMVGTFIADLPYPPYPNTEATVVVVSNYGPEAIWRGVL"
     atgggagttt cacaagtagt agcatatgtg ctattatttt tcattacaat ctcgctagga        60
     ttaattgctt taggagcata tataaaaagt cagcaattct tattacatgc ggaagatatg       120
     aggcaaaata tggatctaaa tcaactcaac actagaatat ttataaagag tgtagcgata       180
     aatggttatc tattatatat gacaataact aataatggat ctactgtatt atatgatttt       240
     aaggatttcg caataattat caaatattat gcaaacgtaa gtaacgtatc tactcttata       300
     atttctaatt acaactactc tactagctta ggcccatata agtgggtctc aaataccgtt       360
     ctaattaatc caaacatggt aggcaccttt atagctgatt taccatatcc tccataccct       420
     aatactgagg cgactgtagt tgtcgtatct aattatggac cggaagcaat atggaggggt       480
     gtactgtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page