(data stored in ACNUC7421 zone)

EMBL: CP001402.PE122

CP001402.PE122       Location/Qualifiers
FT   CDS_pept        complement(108383..108850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0122"
FT                   /product="putative flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40758"
FT                   /db_xref="GOA:C4KK17"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK17"
FT                   /protein_id="ACR40758.1"
FT                   /translation="MASEVISETIMLIVAVTLVGVVAGSVFSVVSSISTNMVSYSILQS
FT                   QKLVTDLQIDYATNASSTTVIVYLHNIGESTIFNLKNSVLYFGPQGNLQQIGYNSSSTL
FT                   PYWVVNTNTLYPGSVAKIIIYLSSPLSTTQYYTVQLVTPNGYSVSYTFEAS"
     atggctagcg aagtgattag tgagacaata atgttaatcg tagcagtcac attagtagga        60
     gtagttgcgg gatcggtttt ttctgtagtg tcatccatat ctactaacat ggtatcatat       120
     agtatattac aatcgcaaaa attggttact gatcttcaaa tagattatgc tacaaatgcc       180
     agttctacaa ctgtaatagt atacttacat aatataggag agtcaacaat ttttaacttg       240
     aaaaatagtg tattgtactt cggcccacaa ggaaatctac aacagatagg atataactct       300
     tctagtacat taccctattg ggttgttaat actaatacat tataccctgg ttctgtagct       360
     aaaattatca tctatttatc ctcaccctta tctactacgc agtattatac tgttcagtta       420
     gttaccccta atggatactc agtaagctat acatttgagg cgagttag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page