(data stored in ACNUC7421 zone)

EMBL: CP001402.PE123

CP001402.PE123       Location/Qualifiers
FT   CDS_pept        complement(108843..109604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40759"
FT                   /db_xref="GOA:C4KK18"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK18"
FT                   /protein_id="ACR40759.1"
FT                   /translation="MINLNLLELQQLMESPLFILLISISIPLAAFFISFFKIVFPRITR
FT                   PKNTQPPQTASTTQQNQQQQQITTNSSKEIEELLKNLINRMDKYQSDLVNVLNGSMEDL
FT                   KQTLQKLNSSIEDAVLSLKSAQADSSSPFNIISEQSKGEQRPEGNKELKAVAEIVGTSN
FT                   IDLSTFIRNCVLLEILDYDDSKLTALYELGYISADDMFIVNKVQSYIRTNSGKIRAKDL
FT                   ANIAMNVAESYSSVTAEMKKYLLVLEVGKNG"
     atgataaatt taaacttact tgaattgcaa caactaatgg aatctcccct atttatttta        60
     ctgattagca taagcatacc cttggcagca ttctttatat ccttttttaa gatagtattt       120
     ccaagaataa ctaggcctaa gaatacacaa ccaccacaaa ctgcttctac tacacaacaa       180
     aatcagcaac aacagcaaat tacgaccaat tctagcaagg agattgaaga gcttcttaag       240
     aacctaataa atagaatgga taaatatcaa agtgatctgg taaatgttct aaatgggtct       300
     atggaagatt taaagcaaac cttacagaaa ttaaattctt caattgaaga tgcagtgtta       360
     tctctaaaat ccgctcaggc tgattcatca tcacctttca atatcatatc agagcagtct       420
     aaaggcgaac agaggccaga aggtaataaa gaattaaagg ctgtagctga aattgttgga       480
     acatccaaca tagatttgag tactttcatc agaaattgtg tattattgga gattttggat       540
     tatgatgatt ctaagttgac agctttatac gaattaggtt acatctctgc agatgatatg       600
     tttattgtga acaaggtgca atcttatatt aggactaata gtggaaagat aagagcaaaa       660
     gatttagcca atattgctat gaatgtagct gaaagttact cctcagtaac tgcagaaatg       720
     aaaaagtatc tattggtatt ggaggtaggg aagaatggct ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page