(data stored in ACNUC7421 zone)

EMBL: CP001402.PE125

CP001402.PE125       Location/Qualifiers
FT   CDS_pept        110723..111208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40761"
FT                   /db_xref="GOA:C4KK20"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK20"
FT                   /protein_id="ACR40761.1"
FT                   /translation="MTPVFLEYKVIHDNITYYIIYIFIYNLSLKLVTMYTINPNSHTIL
FT                   SYNVSLEPQQIFSNITGISTYYSLDGKKILAYENNNGSIIVAYNGLILKKVSNNSVRYL
FT                   IAANYPGIDNSKFPNLYKLAKISIFDTNIRVLVLGVLLTILSSFVLKIMVGRYDKVR"
     atgactccag tctttctaga atacaaggtt atacatgata atattacata ttatattatt        60
     tacattttta tttataactt atcactaaag ttagtaacaa tgtatacaat aaatccaaat       120
     tctcatacaa ttcttagtta taatgtatct ctggagcctc aacaaatttt ttcaaacatt       180
     actggaatat ctacatatta tagcttggat gggaaaaaga ttcttgctta tgaaaataat       240
     aatggaagta taatcgtagc atataatggg ttaattctga aaaaggttag caataactct       300
     gttcgttatc taatagctgc taactatccg ggaattgata acagtaaatt ccctaatctt       360
     tataaactag ctaaaatttc catttttgat actaatataa gggtcctagt tttaggagtt       420
     ttattgacta ttttatcatc cttcgttcta aagatcatgg tgggacggta tgataaggtt       480
     agataa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page