(data stored in ACNUC7421 zone)

EMBL: CP001402.PE126

CP001402.PE126       Location/Qualifiers
FT   CDS_pept        111192..112661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40762"
FT                   /db_xref="GOA:C4KK21"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK21"
FT                   /protein_id="ACR40762.1"
FT                   /translation="MIRLDKNNFIPWISIVFLLFAYSIGTGLYITIQRVTYYPIFESKI
FT                   VSVLLTIFSSSLMTLYNYKRYVFLVPLSLLSFFSVSLTPLIISIFILHELRKVDRTVSI
FT                   ILLIIDASMLSWLTLRLLLGINTYFSFPLMILESGAPTVIPFIWFAGVVFSAYKRDLSS
FT                   KSQLFINPLIPFIVALLISLVPYFPFINPYKFPETVDFKYYYSWLLSPTLSGWFFYSRP
FT                   LYLMLLYTLSFIFKPYTVAYYEFAFLSILYVYSAYKLASALDKSIASLAALLASVSPML
FT                   ITFLYSGLEANLFSISLMFISMSYFLKKEKLSLAILFSLLSMFSHIYAWAQLSASIALY
FT                   YLLKSIRLKSRPDNYTLTYLSFSIPFIAIGFFLILSGVFPVPMGLLNYNQLIYQITVVS
FT                   WGSNNALLYFLVSSFGNKYIKEEVLDFVYSISVFGIIFLAPATNLIIDLPLFIPAAYTI
FT                   RNMDRQSVSVLLLLSLILWGIYMSINSVPML"
     atgataaggt tagataaaaa taacttcatt ccctggattt ctatagtttt tttattgttt        60
     gcttattcca taggtactgg cttgtatata accatacaac gtgttacata ctatcctatt       120
     tttgaatcta aaattgtttc agtacttctc acgatattct catcatcatt aatgactctt       180
     tacaattaca agagatatgt ttttctagtt ccattatctc tattgtcctt cttctctgta       240
     tcattaactc cccttataat atctatattt attttacatg agctaaggaa agttgatcga       300
     acagttagta ttatattgct aataatagat gcgtctatgt tatcatggct cactctacgt       360
     ttactattag gcattaatac ttacttttcc tttcctctca tgattttaga atcgggagca       420
     cctacagtaa ttccatttat atggtttgct ggagtagtat tctctgctta taaaagagat       480
     ttaagtagta agagccaact attcatcaat cccttaattc catttattgt agctctgctt       540
     atttctctag tcccttactt tccttttata aatccttata aatttccaga aactgttgat       600
     tttaagtatt attactcatg gcttctatca cccactttaa gtgggtggtt cttttactcg       660
     aggcctctgt atttaatgct tttatacaca ttatcattta ttttcaagcc gtatacagta       720
     gcgtactatg aatttgcatt tctttctatt ctttatgtat attctgcata taaactagcc       780
     tcagcgctag ataaatctat agcttcccta gcagccttat tagcttcggt atctcctatg       840
     ttaataacct ttctctattc tggtttggag gctaacttat tttcaatttc attaatgttt       900
     atctcaatgt cgtattttct caaaaaagag aaattaagtt tagcaatact tttttcttta       960
     ctatcgatgt tctctcatat atacgcttgg gctcagttat ctgctagtat agctctatac      1020
     taccttctta aatcaattag acttaaatct agaccagaca actatacgct aacttatttg      1080
     tccttttcaa ttccctttat agccattgga ttcttcctaa ttttaagtgg tgttttcccc      1140
     gtacctatgg gattattaaa ctataatcaa cttatatacc aaataactgt agtgagttgg      1200
     ggatcgaata atgctttgct ttactttttg gtatcatcct ttggaaacaa gtatattaag      1260
     gaagaagttc tagatttcgt gtattcaatc tcggtatttg gtattatttt tctggcacca      1320
     gctaccaatt taataattga tttgcctctt ttcattcctg cagcttatac cataagaaat      1380
     atggataggc agagcgtgtc agtattatta cttctgagtt taatactatg gggtatttat      1440
     atgagtatta atagcgttcc tatgctatga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page