(data stored in ACNUC7421 zone)

EMBL: CP001402.PE127

CP001402.PE127       Location/Qualifiers
FT   CDS_pept        112658..113101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40763"
FT                   /db_xref="GOA:C4KK22"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK22"
FT                   /protein_id="ACR40763.1"
FT                   /translation="MIVRFLFYLRRDLLTMRDIYQILLVGIISLLVIITAASRLYVLLV
FT                   PIVLFSIYLITESRIPEIKDLKSFYKYVEKVYGRDFAATIRKKYNIIQGDLTLAYFPSS
FT                   IKDNTIVISNNHLILKLNSKVLVLSKYEGVDYLIDMIKDNRSS"
     atgatagtaa gatttttatt ttacttaaga agagatttat taacaatgag ggatatatat        60
     cagatactat tagttggcat tatctctttg ttagtaatta taactgcagc atctaggctt       120
     tatgttcttc tcgttcctat tgttttgttt tcaatatact tgattactga gtctagaata       180
     ccagaaataa aagatttgaa atcattttat aaatacgtag aaaaagtgta tggaagagat       240
     ttcgcagcca ctattaggaa gaaatataat attattcaag gtgatttaac attggcttat       300
     ttcccgtcat caattaaaga taatactata gttataagca ataatcacct aattttgaaa       360
     ctaaattcca aagtattagt attaagtaaa tatgagggtg ttgactattt aatagacatg       420
     ataaaagata atagatctag ttaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page