(data stored in ACNUC7421 zone)

EMBL: CP001402.PE128

CP001402.PE128       Location/Qualifiers
FT   CDS_pept        113185..113994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40764"
FT                   /db_xref="GOA:C4KK23"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK23"
FT                   /protein_id="ACR40764.1"
FT                   /translation="MSYNVFDILRELDSIVDFARAKLQWDILFFINSKGPSSVSEIAEG
FT                   TNNSKKAVIDAIRKLIEKELIIKIKYDVYDLSDKGKQVLNKLNSFTSNTVPSQNDADHG
FT                   NNTLSNMDNPSQNFYLLELIKISLLNNGILPIDKAYRELGISKQTLKYYLELFMQKKIF
FT                   KKVNKKNFLGRNIQSAVLTSEGRKIAYRVPSLIKIRNNLFLRLLLKMTFSISYESALLK
FT                   LMVFFALSSPIIIYYDGDAPIRMIGILWLYMLVFTSLLSVFAYLTMR"
     atgtcatata atgtgttcga tatcttaaga gaactagatt caatagtaga ttttgctagg        60
     gctaaattac aatgggatat tttatttttc attaattcta aggggccctc atctgtttca       120
     gaaatagccg agggcaccaa taacagcaaa aaggccgtaa ttgatgctat aaggaaactt       180
     atagaaaagg aactgattat taagattaag tatgacgttt acgatttgtc ggataaggga       240
     aagcaagtat taaataaact caattccttc acatctaata cagtacctag tcaaaatgat       300
     gctgatcacg gaaataacac gttatcaaat atggacaatc cttcacagaa cttctattta       360
     ttagaattga taaagatatc tttgcttaat aatggtattt tacctattga caaagcgtat       420
     agagaattgg gaatttcgaa acagacactc aagtattatc tagaattatt tatgcaaaag       480
     aagattttta aaaaagttaa caagaagaac ttcttaggaa ggaatattca aagtgcagtg       540
     ctaactagtg agggaaggaa aatagcgtat agggtaccta gtctaattaa aataagaaat       600
     aatttatttt taaggttatt attaaaaatg acttttagta taagttatga atcagccttg       660
     ctgaaactta tggttttctt cgcgttatcg tcacctataa taatatatta tgatggtgat       720
     gcccccattc gtatgattgg cattttatgg ttatatatgt tggttttcac ctcactattg       780
     agtgtattcg cttatttaac aatgagatag                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page