(data stored in ACNUC7421 zone)

EMBL: CP001402.PE129

CP001402.PE129       Location/Qualifiers
FT   CDS_pept        114008..114493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40765"
FT                   /db_xref="GOA:C4KK24"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK24"
FT                   /protein_id="ACR40765.1"
FT                   /translation="MELANVSLLYLITGNYTHYLMLITILNVSKNFAIINMTEISHNIT
FT                   LSYVVAYPIFLLYVPNVTQQSTVTQFEGINTTILNIRNFTIYVDVYNGIVIHYIGHGIN
FT                   ATLIGATIPLGPGVYKLIPSYMLGHQRNNNVEEYETVLLTIVLVVSFYIIFERMDKK"
     atggagttag ctaatgttag tcttctatat ttaataactg ggaattatac tcattatctt        60
     atgctgatta ctatacttaa tgttagcaaa aattttgcta ttataaacat gactgagata       120
     agtcataaca ttacattatc atatgtcgta gcttatccaa ttttccttct ttatgtacca       180
     aatgtaacac aacaaagtac agtcactcag tttgagggga taaataccac tattctaaac       240
     atacgcaatt ttacaattta tgttgacgta tacaatggca tagtgataca ttacatagga       300
     catggaatta atgcaactct aattggagct acaattcccc taggcccagg ggtgtataaa       360
     ttaatccctt cctatatgct aggtcaccaa agaaataata atgtagaaga atacgagaca       420
     gttcttctta cgattgtgct agtagtttcg ttctacataa tttttgagag gatggataaa       480
     aaatga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page