(data stored in ACNUC7421 zone)

EMBL: CP001402.PE13

CP001402.PE13        Location/Qualifiers
FT   CDS_pept        9080..9883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0013"
FT                   /product="band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40649"
FT                   /db_xref="GOA:C4KJC9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJC9"
FT                   /protein_id="ACR40649.1"
FT                   /translation="MAINVGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLR
FT                   IKGPGIIFLIPFVDRPLIVDLRVNTVEVPPQTILTRDNVTVSVDAVVYYKVVDPQKAVL
FT                   SVYNYNVAVLNLAQTSLRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVT
FT                   IRDIRLSQDLLSAMAKQAEAERLRRAKVILSEGERQAASILADASTYYKDNPSALQLRF
FT                   LETLSDISQRGGLIIVVPAGNEIYPTLGTSAALSTLSKKLQTETK"
     ttggcaatta atgtaggaga catagtaggc atagtatttc taatcattat aataatcatc        60
     tttattgcca tgtcatttag agtagtcaga gaatgggaga gagccgttgt gttgagatta       120
     gggagatttt taagaataaa aggccctgga atcatattcc ttataccctt tgttgataga       180
     ccattaatag tagatctaag agtaaatact gttgaggttc cacctcaaac tatcttaact       240
     agagataacg ttactgtaag tgtagacgct gtagtgtact ataaagtggt tgacccacaa       300
     aaagcagtat taagtgttta caactataat gtagcagtac taaatttagc tcaaacctca       360
     ttaagggata ttgttggaca aatggaatta gatgagctat taagtaaaag ggaagaaatc       420
     aataagagga tacaagaaat attagatgtt acaactgaag ggtggggaat taaagtcacc       480
     gctgtaacta taagagatat tagattatct caagatttgt tatctgctat ggcaaagcaa       540
     gctgaggcag agagattaag aagagcgaag gtaatactaa gtgaaggtga gagacaagct       600
     gcaagtattt tagctgacgc atctacttat tacaaggata atccatcagc attacagtta       660
     aggtttttgg aaacattatc agatatttca caaagaggag gtttaataat tgtagttccg       720
     gcaggaaatg aaatataccc tactctaggt actagtgctg cattatcaac tctctcaaaa       780
     aagttacaaa ctgaaaccaa atag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page