(data stored in ACNUC7421 zone)

EMBL: CP001402.PE130

CP001402.PE130       Location/Qualifiers
FT   CDS_pept        114490..114672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40766"
FT                   /db_xref="GOA:C4KK25"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK25"
FT                   /protein_id="ACR40766.1"
FT                   /translation="MKIYNLGRALVLTGIVELILASLFYSDKRVILSVLLGDYSYFCLL
FT                   IGVIVIAVYGAITKN"
     atgaaaatat ataatctcgg aagggcttta gttttgactg gtatagtaga gttaatatta        60
     gcttctcttt tttattctga taagagagtt attttatcag tattattggg ggattattcg       120
     tatttttgcc tacttattgg tgttatagtt atagccgtat atggagcaat aactaagaat       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page