(data stored in ACNUC7421 zone)

EMBL: CP001402.PE132

CP001402.PE132       Location/Qualifiers
FT   CDS_pept        116308..117036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK27"
FT                   /protein_id="ACR40768.1"
FT                   /translation="MGAIYVLGVKGGIGKTTFSLYFAKRLSLMGKKVMYIDHDYFSFGC
FT                   LILGHNDLGLLEEIERNLPIFSRSLKNIDNLYVLKLFSNPLNINKNYSLLSNKIPQVLN
FT                   SILKREVDYIILDSSVGILPDNDIVMALLEELEIEKEGVFLSDMLSVNSTIKYAKLWEN
FT                   NIKYKVLVINMVPPIPENLSEAIKIANEVYNNYKELFNAAIVVQFDEKMYNYNPIIAEY
FT                   ENEKLNSILLSILYRYNTLK"
     atgggagcca tttatgtact tggagtaaaa ggaggtatag gcaaaacaac tttttctctt        60
     tattttgcta aacgcttgtc tttaatgggt aaaaaagtta tgtatattga tcatgattat       120
     ttttcctttg gatgtttaat attaggacat aatgaccttg gacttctaga ggagatcgaa       180
     cgcaatttgc caatattttc aagaagttta aaaaacattg ataatcttta tgtcttaaaa       240
     cttttttcaa atcctttaaa cataaacaag aattattctt tattaagcaa taagataccg       300
     caagttttaa atagtattct taagagagaa gtggattaca ttattttaga ttcttcagta       360
     ggtatacttc cagataatga tattgtaatg gcattactag aagagttaga gatagagaaa       420
     gaaggagtgt tcttaagtga tatgctgtct gtaaattcca ctataaaata cgctaaatta       480
     tgggaaaata atataaaata taaggtatta gttataaata tggttccacc aataccagaa       540
     aacctatctg aagctataaa aattgcaaat gaagtctata ataattataa agagctattt       600
     aatgctgcta tagttgttca atttgacgag aaaatgtata actataatcc aataattgct       660
     gagtacgaaa acgagaaact gaatagtata ttattatcta tactttatcg atataatact       720
     ctcaaataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page