(data stored in ACNUC7421 zone)

EMBL: CP001402.PE133

CP001402.PE133       Location/Qualifiers
FT   CDS_pept        117297..118064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40769"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK28"
FT                   /protein_id="ACR40769.1"
FT                   /translation="MIRINVVGFKGGSGKSTVSYYLARQLSEYYNVVLVDKTYSGTISR
FT                   IYNINNNIFSFLKGRNELFYVSKNSFSVINMSFSSENDLNNFDFNTFKYLYGKLIKDSD
FT                   IVVVDHSSIPHDFATEIELKAFMENFKNFAYNTVLVLSGDEIPIKRYLNYTTLLNDFVK
FT                   NYAEKILGISLPRDVKFLKIIAVIINKILKGQESKLEEFIRGDEILQRSARFVIPFYLS
FT                   LTQRHFKDIEPPKEIIDIVRYILDLLREPTSIL"
     atgattagga taaatgtggt tggatttaaa ggtggttctg gaaaatctac tgtatcgtat        60
     tatttagcca gacagctaag tgagtattac aatgtagtac ttgtagataa gacatattct       120
     ggaactataa gccggatata taatattaat aataacattt tttcctttct gaaaggaagg       180
     aacgagttat tttatgttag taagaatagc ttttcagtta taaacatgtc cttttcaagt       240
     gaaaatgatc ttaataattt tgattttaac acattcaaat acttgtatgg taaattaata       300
     aaggatagtg atatagttgt tgtagatcat tcatctattc ctcatgactt cgcaaccgag       360
     atagagttaa aggcatttat ggaaaatttt aaaaactttg catataatac agtattagtt       420
     cttagtggag atgaaattcc gataaaaaga tatttaaact atacaacgct gctaaatgat       480
     tttgtaaaga attacgctga gaaaatctta ggtatttctt taccaagaga cgttaaattt       540
     ctaaaaatta tagcagtaat tataaataaa atcctcaaag gtcaagaaag taagttagag       600
     gaatttataa gaggagacga gattctgcag agatctgcta gatttgttat tcccttttat       660
     ctttctctaa cgcaaaggca tttcaaagat attgagcccc ctaaagagat aattgatatc       720
     gttagatata tattagattt gttgagagag cccacctcga ttttatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page