(data stored in ACNUC7421 zone)

EMBL: CP001402.PE134

CP001402.PE134       Location/Qualifiers
FT   CDS_pept        complement(118059..119054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0136"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40770"
FT                   /db_xref="GOA:C4KK29"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK29"
FT                   /protein_id="ACR40770.1"
FT                   /translation="MKALVFDKSGLENLKVKEVQEPQLGPHDVLIRVVKSGLNPIDYFV
FT                   ISAIPVTPMPHIPGVEVAGIVEKVGDHVKGLAKGDKVVVYNRVFDGTCDLCLSGKEMLC
FT                   RNGGIMSVITNGGWSEYFSVPDKNVFKIPENMSWDIAASLPVAALTSYHSLKELKVSPN
FT                   DFVVIFGAGGNTGIFAVQLAKKFGATVIAVSRKNWLKDFGADYIIGYDDIVQKVKEITN
FT                   GKMADIVMNSLGSSVWEKSLEVLGLSGQLAFFGGLTGSEVKVNLSSLYGKHIKVVGTTG
FT                   GSRKELTELINICKDCKVKVHKTYRLDEGIEAVKQIMTENRDGRIMLQVS"
     atgaaagccc tagttttcga caagagtggt ttagaaaatc tcaaggtaaa agaagttcaa        60
     gaaccacaat taggtccaca tgacgttttg ataagagtag ttaaatctgg tttaaaccct       120
     atagattact tcgtaattag tgcaattcca gttaccccaa tgccccatat ccccggtgtg       180
     gaagtagcag gaatagttga aaaagtaggg gatcatgtga aaggactagc taaaggagat       240
     aaggtagtag tatataacag agtgtttgat ggaacttgtg atttatgcct atctggaaag       300
     gaaatgctat gcagaaacgg cgggataatg agtgttataa ccaatggcgg atggtcagaa       360
     tatttttcgg ttccagataa gaatgttttc aaaattccgg aaaatatgag ttgggatatt       420
     gctgcaagtt tacctgtagc tgctctaact tcgtatcatt ctttaaaaga attaaaagtc       480
     tctcctaatg attttgtagt aatctttggt gcaggtggca atactggtat ctttgcagtt       540
     caactggcaa aaaagttcgg agcaacagta atagcggttt caagaaagaa ctggctaaag       600
     gactttggtg cagattatat aataggatat gatgatatag tacaaaaggt taaggaaata       660
     actaatggga aaatggctga tatagtaatg aactccttag gctcctcggt atgggaaaaa       720
     agcttagaag ttctaggttt aagtggtcaa ttagcattct ttggagggct aaccggaagt       780
     gaggtgaagg taaatttgag ttccttatac ggaaaacata taaaggtagt tggaaccaca       840
     ggtggatcta gaaaggaact aactgaattg ataaatatat gtaaagattg caaggtaaag       900
     gttcacaaga cttacagatt agatgaaggt atagaggcag taaaacaaat tatgaccgaa       960
     aatagggatg ggagaataat gttgcaagta tcataa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page