(data stored in ACNUC7421 zone)

EMBL: CP001402.PE135

CP001402.PE135       Location/Qualifiers
FT   CDS_pept        complement(119104..119469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40771"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK30"
FT                   /protein_id="ACR40771.1"
FT                   /translation="MLMSVIEKFVKHIEKVYDNEEVRMLENLWMKKITNFPINLQVVEE
FT                   EDGEKLHLFVLKGAEAILLHKSTSIFLYITNLTSVELETLRYITIKKKGEEADEDFVSL
FT                   AYEYISFKNKAKIGIRQ"
     atgctcatga gcgtgataga gaaatttgtt aaacacatcg aaaaggtata tgataatgaa        60
     gaggtaagaa tgctagaaaa cctatggatg aaaaagataa ctaattttcc aattaatcta       120
     caagttgttg aagaagaaga tggagaaaag ctgcacctat ttgtacttaa aggagctgaa       180
     gccattttat tacacaaatc cacgagcata tttttataca taactaactt aacatcagta       240
     gaactagaga ccttaagata cattacaata aagaagaagg gtgaagaggc tgatgaagat       300
     ttcgtaagct tggcgtatga gtatattagc tttaagaata aggctaagat agggataaga       360
     caatag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page