(data stored in ACNUC7421 zone)

EMBL: CP001402.PE136

CP001402.PE136       Location/Qualifiers
FT   CDS_pept        119551..120162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40772"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK31"
FT                   /protein_id="ACR40772.1"
FT                   /translation="MTTNIVRVLSIKGGVGKSSIAYALTRTISASGYKVLFLDMDNLHT
FT                   ISRVLGVKDCELTYVRDFFVFACDDFSKISFTNYEYVIIDTYSGISTETLSVIKGDLIY
FT                   NIFISDFSSIDNSLSYIKEWNGKRSINFLVVNMVIVEDNEYDILLRKFFDSLALKSNVK
FT                   INKVFLFFFDENYYGSYKVDLNHIELLASYVLGGIGESDP"
     ttgacaacca atattgttag agttttgagt attaagggtg gtgtcggtaa aagctctata        60
     gcttatgcgt taacgagaac catctctgct tctgggtata aggtattatt tttagatatg       120
     gataaccttc acaccatttc gagagtattg ggagttaagg attgtgagtt aacatacgta       180
     agggattttt tcgtatttgc atgtgatgat tttagtaaaa tttcttttac caactatgaa       240
     tatgtgataa ttgatactta ttctgggatc tccactgaaa cgctttcagt tattaagggg       300
     gatcttattt acaatatttt tatttcagac ttttcttcta ttgataattc tttaagttat       360
     ataaaagagt ggaatggtaa gagaagtatt aatttcttag ttgtaaatat ggtcatagtg       420
     gaagataacg agtatgatat tttattacga aagttttttg attccttggc tcttaaaagt       480
     aatgtgaaga taaataaggt atttttgttt ttcttcgacg aaaattatta tggatcctat       540
     aaagttgatc taaatcatat agaactctta gctagttatg tactaggtgg aataggtgaa       600
     tctgatcctt ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page