(data stored in ACNUC7421 zone)

EMBL: CP001402.PE137

CP001402.PE137       Location/Qualifiers
FT   CDS_pept        120397..121266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0139"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40773"
FT                   /db_xref="GOA:C4KK32"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK32"
FT                   /protein_id="ACR40773.1"
FT                   /translation="MSHYTVRNIIEIILCGGRDLNPRRPSPAEPQSAVGDTPTPPRLKY
FT                   LDKLKEVVRTDENNREYNLEQFFEWCVKKRGNSEDTCKDYVSYLKRPLDKSKKWSVIAY
FT                   KLYYEFLGKEDKAKELKVEKKVNIPVYRVPSVEEINAVLNHEDERIRILYRLLLESGVR
FT                   LKEALFILNNYDSSLDQREDGFYVYTVNLVRKSKKSFYAFHVTPLKKTYITENIVDHAN
FT                   LPVRPKFIRKFVATKMLELGIPSEVVDFFQGRTPSSILSKHYLDLLTLAKKEYKKYIEW
FT                   LKNIYIPI"
     gtgtcacatt ataccgtaag aaatataata gaaataattt tatgcggggg acgggatttg        60
     aacccgcgca ggccttcgcc agcggagcct cagtccgcag tgggggatac ccccacaccc       120
     ccaagattga aatatttaga taaattgaaa gaagttgtac gcacggacga aaacaaccga       180
     gagtacaact tagaacaatt ttttgaatgg tgcgttaaga aaagaggaaa ttcggaagat       240
     acatgcaaag attacgtttc atatcttaaa cgcccactgg ataaaagtaa aaagtggagt       300
     gttatcgctt acaaattata ttatgagttt ctaggaaaag aggacaaagc caaagagttg       360
     aaagttgaga agaaagtaaa tatccccgtt taccgcgtgc catcagttga ggaaataaat       420
     gcagtgctaa accacgagga tgaacgcata cgcatacttt accgcctact tcttgaaagc       480
     ggggttagac taaaggaagc gttattcata ttaaataatt atgactcatc actagaccag       540
     agggaagacg ggttttatgt ttatactgtg aacttagtca gaaagagcaa aaaatcattt       600
     tacgcatttc atgttacacc gttaaagaag acctatatca ccgaaaatat agtagatcat       660
     gcaaacttac ccgtaagacc gaaatttatc cgaaagtttg ttgccacaaa aatgttagaa       720
     ctaggtattc cctctgaggt cgtagacttc ttccagggtc gtacaccgag ttcaatctta       780
     tcgaagcatt acctagattt actcacttta gcaaaaaaag agtataagaa atacatagaa       840
     tggctaaaga atatctatat ccccatatag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page