(data stored in ACNUC7421 zone)

EMBL: CP001402.PE14

CP001402.PE14        Location/Qualifiers
FT   CDS_pept        complement(9914..11005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40650"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD0"
FT                   /protein_id="ACR40650.1"
FT                   /translation="MNINEIIKKVNELATKDVDERGKINMATNLIFDDITSNNSELKIG
FT                   ILEEIIDSDHIACAVDGSKYEIELSDVTLILARAVKILGKKKDKKSVPSEIAEDFKIIE
FT                   NYYDKNVISNKSILFMLSLETGLIEKCEDCDVIFIDGPIVDPPTYYEEDVEIENILSLD
FT                   KLALYRSTVLRRLKSKNKLIMGIVKNFSHRILIKEFLNSYPALIKARENYIISNIMYKY
FT                   RLEKSEFNKPIFLGWINWDSLINNQIILDDLKGISKAYNQYKKAFNYSLSIYSLYYQYN
FT                   ITSPIVRIDMLSEKEPDFTPIKYLNTWAMQGIREVTLLNKLADELSEINSQDAKKYALL
FT                   FNLARENYLDMNDKLAELMMRKT"
     ttgaatatta atgagataat caaaaaggta aatgagttag ctaccaagga tgttgatgag        60
     agaggaaaga taaacatggc aactaacttg atttttgacg atattacatc aaataattcg       120
     gaattaaaaa taggaatact tgaagagatt atagattctg accacatagc atgtgcagta       180
     gatggaagta aatatgaaat agagctaagt gatgtaactc ttatcctagc tagagctgtg       240
     aagatcttag ggaaaaagaa ggataaaaag agtgttccgt ctgagatagc tgaagatttc       300
     aaaataatag agaattacta tgataagaac gtaatatcca ataaatccat tctatttatg       360
     cttagtttag aaactggttt aattgagaag tgcgaggatt gtgacgtgat atttatcgat       420
     ggacctatag tggatcctcc cacatattat gaagaggacg ttgagataga aaatatctta       480
     tcgctggata agttagcact atatcgttct acagtactca gaagattaaa gagtaagaac       540
     aaattaatca tgggaatagt aaagaacttc tcccatagaa tattgatcaa ggaattttta       600
     aatagctatc cggcgctgat taaggcaagg gagaattaca taatatctaa tattatgtat       660
     aaatatagac tcgaaaagtc tgagtttaat aaaccaatct ttctaggatg gataaattgg       720
     gattcgttaa taaataatca gataatacta gatgatctaa agggaatctc aaaggcttat       780
     aaccaatata aaaaggcatt taactactca ctctcaatat actctctcta ttaccagtat       840
     aatataacat caccaatagt cagaatagat atgttgagtg aaaaggaacc tgacttcaca       900
     ccaattaaat atttgaacac atgggctatg caaggtatta gagaagttac gttattgaat       960
     aaactagctg acgagctttc ggaaataaat tcacaagatg caaaaaaata tgcattacta      1020
     tttaacttag ctagagaaaa ctatttagat atgaacgata agctggcaga actaatgatg      1080
     agaaagacgt aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page