(data stored in ACNUC7421 zone)

EMBL: CP001402.PE140

CP001402.PE140       Location/Qualifiers
FT   CDS_pept        121966..122262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40776"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK35"
FT                   /protein_id="ACR40776.1"
FT                   /translation="MWFRKKPKVEEHLTKFLNEHPGKMVIGDGLYLVGIAAYEYGIPGI
FT                   KYRLIVDIPQEVWRRLLEYLNVTGDPEVLFIEKNKVLPLTREEAKKLLLSERK"
     atgtggttcc gtaaaaaacc gaaagttgaa gaacatctaa caaagtttct gaacgaacat        60
     ccgggaaaga tggttattgg tgatggtctg tatctcgtag ggattgctgc atacgaatac       120
     ggtataccgg gcataaagta taggttaatc gttgatattc cgcaagaagt ctggagaaga       180
     ttgctggaat atctaaatgt aacgggcgac ccggaagtgc tcttcataga aaaaaataaa       240
     gtacttcctt tgacgcgtga agaagcaaaa aaactacttc tttcagagcg taagtag          297
//

If you have problems or comments...

PBIL Back to PBIL home page