(data stored in ACNUC7421 zone)

EMBL: CP001402.PE142

CP001402.PE142       Location/Qualifiers
FT   CDS_pept        complement(122418..126488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40778"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK37"
FT                   /protein_id="ACR40778.1"
FT                   /translation="MIYRPHFTYIEASIPNQVVAREAAANASKKREKERQIVIRPVQEW
FT                   RPPVTRHIVEEWRPPVIRPVNNEEIPAHRQNNGMLIGPHEQKSTDNRPKGVVTAPSPPP
FT                   RHGLGLPRREDNVPNGEPTLFTIRQNVLKDINRLGDLISQANETQTTTEPNLFTIRQNV
FT                   QNNVNRLSNSSEQTTSTQSTSTQNNVLGTSRINRFESGVKQTTGVRTNTSQQNNPQQMI
FT                   DQMISQGVNVTASVNPQQNIDQMISQGVNVSAGATPSGNIIAQGSTGSSGGGNPFGAIG
FT                   SFFSNVGKDISNAVQTVGSTVSNALGTVNNAINNAYNSAYGIQPTTPPQTLNLNAGTTT
FT                   NTQQMINQMVNQRNQVASTSSDTNPLQQFFNDIAKGSALVGYYATEGLGGVGEELANVV
FT                   TGHGLENFSQAVQQFNQAGGQNIARTVGNVTEVALPAIATAVVAPELLPAELIGEASSV
FT                   GLGEAISKITTGKWQSLPQVLQEANEGGILGVIGGAAGSAAEGALAKLGTMVGGKVGDI
FT                   LAGAGGKALAGAAVNEALTAPFTRNPEQLLTAGVLGALGGAASSFVHAEDVPVLEQSEA
FT                   VRNAIDTSEAGARLGNQIVNSAIKKGILDVEEINGRTTTEIGDVLRSKLNNLQSTVLSR
FT                   LNNDDLAALREKGVIDENGNVLKTEDFAKFVKGKLPEGKLYNETLKLLDEYNKGIEKIV
FT                   GGFKVSIGDRTLLYKLKAGDERDFGLGSAGKSDLFNKLRATSDIDKNVAGIYRTTSDVR
FT                   DTAVGLSRAGNVKDADLLMNVYKATKDLKVLHNLKPGDLDLEFKNLGDLSKPVGETIKD
FT                   YFSQPEFSNRVLIYGSNSIKQYLEDIATRYGGEFRGDLSKDYYYVVKGDKPVLALRKPG
FT                   DVDVFVRTDDPAELNKIAQDLADRLNKVAGTDRFEAQGHLVVDKVTGDHVADLHMQNEA
FT                   SDIHNLYARNQGSNLGMGDQTPYYVKEGDARLGVAKLSQMARTKANAIAELREASIEDV
FT                   LKQINEGIKVDDKNIDMIVKNVERLASSNDDAIAYFVKNIKDPELRDALAERFAEDLKL
FT                   TKDDLLNRNVNVDAIKDILTRKEQWISPASYRLKDAEDFLRLMKTEADLSGDPEKLALY
FT                   ERLEADFKERGWIPEDWKPEGTIDSETLEGAQRFMRSITSESTESAYVSTPPSIILPPS
FT                   SVIISTPPSPVTSPPPSPIISPPPSPITSPPPSPIISPPPSPVTSPPSSPITSPPPPPS
FT                   PPPPPPPRVIIPPSPIISPPPSPPPPPPPRVIIPPSPTISPPPSPSPPPPPIISPPPPP
FT                   PPPPPPPSPTEEVIIASQSPPPPVFSPSVILGSSPPPMGPPPFIATLPPGYMGFGGGER
FT                   REISGMAGEMIVL"
     gtgatctata gacctcattt tacgtacatc gaagcatcaa taccaaacca agttgttgca        60
     agagaagctg cagcaaatgc atcaaagaag agagagaaag aaagacagat agtaataaga       120
     ccggttcagg aatggagacc tcccgtcacc agacatattg tagaagaatg gagacctccc       180
     gtaatcagac cggtaaataa tgaggaaata cccgcacata gacagaataa cggtatgtta       240
     atagggccac acgaacaaaa aagtaccgat aatagaccga aaggagttgt tactgctcct       300
     tcaccacctc ccagacatgg gcttgggtta cctaggagag aagacaatgt accaaacgga       360
     gagccgaccc tattcacaat cagacagaat gtattgaagg acatcaatag actaggtgat       420
     ttgatatcac aagcaaacga gacacagacg actactgaac ctaatctatt cacaatcaga       480
     cagaatgtac aaaataatgt taatagactg agtaactcat cagaacaaac aacatctaca       540
     cagtcgacat ctacgcaaaa taacgtactg gggacatcac gtattaaccg atttgagagc       600
     ggggtaaaac agacaaccgg agtgagaacg aacacttcac aacagaacaa cccccaacag       660
     atgattgatc agatgataag tcagggagta aatgttaccg ccagcgtcaa tccccagcaa       720
     aatatagacc agatgattag tcaaggggtt aacgttagcg ctggtgctac tccatctggt       780
     aacattatag ctcaaggttc aactggttca agcggtggcg gtaatccgtt cggtgcgatc       840
     gggtcatttt tctctaacgt aggtaaggac ataagcaacg cagtacagac cgtcggatcc       900
     accgttagta acgcattggg aaccgtgaat aacgccataa ataatgcgta taatagtgct       960
     tacgggatac aaccaacaac ccctccgcag acgttaaacc tcaatgccgg gacaacgacg      1020
     aacactcaac aaatgataaa ccagatggta aaccagagaa accaagtagc gtcaacgagt      1080
     agcgatacaa accccttgca gcagttcttt aatgatattg caaagggttc tgctcttgtg      1140
     ggctattatg ctactgaggg gcttggagga gtaggtgagg aattggcaaa cgtggtcacc      1200
     ggtcacggac tggagaactt ctctcaagca gtccagcaat ttaatcaagc gggagggcaa      1260
     aacattgcga ggactgtggg taacgttacg gaagttgcat tgcccgctat cgctacggcg      1320
     gttgtagcac ctgagttatt gcctgcggaa ttgatcggtg aagcttcctc agtaggactt      1380
     ggtgaggcca tatcgaagat cacgacaggt aagtggcaat ctcttccgca ggttttacaa      1440
     gaagctaacg aaggcggtat attaggcgta atcggcggtg ctgcgggcag tgctgcagaa      1500
     ggtgcgttag cgaaactggg gacaatggta ggcggtaagg tcggcgacat cttagcgggg      1560
     gcagggggta aagcattagc gggagctgcg gttaatgaag cattaaccgc gcccttcacc      1620
     agaaacccgg agcagttact aacggcaggt gtcctaggtg cattaggtgg cgctgcatcg      1680
     agtttcgttc acgctgaaga tgttccagta cttgagcaaa gcgaagccgt aagaaacgct      1740
     atcgatactt cagaggccgg cgctaggcta ggaaaccaga tcgtgaattc cgcgatcaaa      1800
     aaaggcattc ttgatgtgga agaaattaac ggtaggacga ccactgaaat aggagacgta      1860
     ctgagaagca aattaaacaa tctacaaagt acagtcttat cgagactgaa taatgacgat      1920
     ttagccgcgt tgagagaaaa gggtgtaatt gacgagaacg gcaacgtgtt aaaaacagag      1980
     gatttcgcta agttcgtgaa aggtaaacta ccggagggca agctatataa cgagacgctg      2040
     aagttgttag atgagtacaa taaaggtata gagaaaatag tcggcgggtt taaagtcagt      2100
     ataggagata ggacgttact ttataagtta aaggccggcg atgaaagaga ctttggctta      2160
     ggtagtgctg gaaagtcgga tctatttaac aaattaagag caacaagcga tattgacaag      2220
     aacgtagccg gtatatatag gactacaagt gatgtgagag atacggcagt aggattatca      2280
     cgtgccggga acgtgaaaga tgcggaccta ttaatgaatg tctataaagc aacaaaagat      2340
     ctgaaagtat tgcataactt aaagcccgga gatttagact tagaattcaa aaacctaggc      2400
     gatctgagta agccggtcgg agagacgatt aaggattact tctcgcaacc ggaattcagt      2460
     aaccgcgttc ttatttacgg gtcgaatagt ataaagcagt acttggaaga tatcgcaaca      2520
     agatatggcg gagaattcag aggtgatctt agtaaagact attactacgt agtaaaaggt      2580
     gacaagcccg ttttagcgtt aagaaagccc ggtgacgtgg acgtcttcgt gagaactgat      2640
     gaccctgcgg agcttaacaa aatcgcccag gatttggcgg ataggcttaa caaagttgcc      2700
     ggaaccgata gatttgaagc ccagggtcac ctggtagtcg ataaagtcac gggcgaccac      2760
     gtggcagact tacacatgca gaatgaggcg agtgatatac ataacctcta cgccaggaat      2820
     caaggatcaa acttaggtat gggcgatcag acgccctatt acgttaagga aggagacgcg      2880
     cggttgggcg tggctaagct atcacaaatg gcgaggacta aagcgaatgc gattgcggag      2940
     ttaagagaag cgtcaatcga ggacgtgtta aagcagatca acgaggggat aaaagtagat      3000
     gataagaaca tcgatatgat tgtaaagaac gttgagagat tagcttcatc taatgacgat      3060
     gcaatagcgt atttcgtgaa gaatattaag gatccagaac tgagggacgc gctagcggaa      3120
     agatttgcgg aagatttgaa gctaacgaaa gatgatttgc taaacagaaa cgtgaacgtt      3180
     gatgcaatta aggatatact gacaagaaag gaacaatgga tatcgcccgc gtcgtatagg      3240
     ttgaaggacg cggaggactt tctgagatta atgaaaacgg aggcggactt atcgggagac      3300
     cctgaaaagt tggcccttta tgaaagactg gaagcagact ttaaggagag aggctggata      3360
     cctgaggatt ggaagccgga agggacaata gattcagaaa ctctagaggg agcgcagagg      3420
     ttcatgagaa gtattacatc agaatcaaca gagagcgcat acgtgagcac gcctccatcc      3480
     atcatattgc cgccgtcttc agtaatcatt agcacgccgc cttcacccgt tacttcgcct      3540
     ccacctagtc ctatcatatc gcctcctcca tcaccgataa catctcctcc tccgagtcca      3600
     ataatatctc ctccgccatc tcccgttaca tcgcctccgt cttcaccgat aactagcccg      3660
     ccaccgcctc caagtccacc accgcctccg ccacctaggg ttataatacc gccatcgccc      3720
     ataatatcac ctccgccatc tccaccgcct cctccgccac ctagggttat aatacctccg      3780
     tctccaacaa tatctccacc tccatcgcca tctccaccac cgccaccgat aatatcgcct      3840
     ccgccaccac ctccgcctcc accccctccg ccaagtccaa ccgaagaagt gataatagct      3900
     tctcagtctc cgccaccgcc cgtgtttagt ccttcagtta tactaggttc gtcaccgcca      3960
     ccgatggggc caccgccgtt tatagcaacg ctaccgcccg gttacatggg gttcggtggc      4020
     ggagagagac gagaaattag cggtatggca ggagagatga tagtgttatg a               4071
//

If you have problems or comments...

PBIL Back to PBIL home page