(data stored in ACNUC7421 zone)

EMBL: CP001402.PE144

CP001402.PE144       Location/Qualifiers
FT   CDS_pept        126751..127092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40780"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK39"
FT                   /protein_id="ACR40780.1"
FT                   /translation="MEKLNNRFVAEIEDDGVRVMRLENFFKLKCTLARKDIERVLNIIH
FT                   IILEYIPVANLEEETVFAVPFRYLEDVQFLAKLCNAKIEVMIKRRPRLAYVKWIPKDII
FT                   NNDAANDDE"
     atggaaaagc taaacaaccg attcgttgcg gagatagagg atgacggcgt tcgtgtgatg        60
     aggttagaaa attttttcaa attgaaatgc acactggcga gaaaagatat cgaaagagta       120
     ctaaatatta ttcacattat tctagaatat atcccggtgg cgaacctcga agaagaaaca       180
     gttttcgcgg taccttttcg gtatcttgag gacgtgcaat ttttagctaa actttgcaac       240
     gcaaaaatcg aagttatgat aaagagaaga ccgcgactcg cttatgtaaa atggattccg       300
     aaagacatta ttaataacga cgccgctaac gatgatgagt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page