(data stored in ACNUC7421 zone)

EMBL: CP001402.PE148

CP001402.PE148       Location/Qualifiers
FT   CDS_pept        128219..128548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40784"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK43"
FT                   /protein_id="ACR40784.1"
FT                   /translation="MRANNCLNRRTNMPTQIQFGTNWVQVKGSIFYLTPHALRVVKEFY
FT                   EEAKADNIKVDIEYLAKAFELLKPESEAEAKKFIDILNEIYPETKEIIDRIYTNKNAYN
FT                   TVREL"
     atgcgggcaa ataattgttt aaataggcgt acgaatatgc ccacgcaaat tcaattcggt        60
     acaaattggg ttcaagtcaa aggaagtatt ttttacctaa ctcctcatgc cctaagggtc       120
     gtgaaggagt tctacgaaga agcaaaagca gataacatta aagtagatat agagtactta       180
     gctaaagcgt ttgaactact aaagcccgag agcgaggcag aagctaagaa gtttatagat       240
     atattaaatg agatctatcc tgaaacaaag gaaatcatag accgtatata tacaaacaaa       300
     aacgcctata acacggtgag agagctatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page