(data stored in ACNUC7421 zone)

EMBL: CP001402.PE149

CP001402.PE149       Location/Qualifiers
FT   CDS_pept        128545..128778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40785"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK44"
FT                   /protein_id="ACR40785.1"
FT                   /translation="MIVPVYIHHYELEKICESDGEYAVCDNYYADHEYTIDDVEFDYGD
FT                   LEGIVDRYLDDILEILQKNYKKKLNMLLKTNR"
     atgatagtac ccgtttatat tcaccactac gaactagaga aaatttgcga aagcgatggc        60
     gaatacgcag tatgcgacaa ttactacgcc gaccatgagt atacaattga cgatgttgag       120
     tttgattacg gtgatctgga gggtatagta gaccgctatc ttgatgatat tctagaaatt       180
     cttcagaaga attataagaa gaaattaaat atgttattga aaacaaatcg ttaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page