(data stored in ACNUC7421 zone)

EMBL: CP001402.PE15

CP001402.PE15        Location/Qualifiers
FT   CDS_pept        complement(11002..11691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40651"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD1"
FT                   /protein_id="ACR40651.1"
FT                   /translation="MDLDEFIEKLTQYKQNLDVEKLREEDRKITEMIEELEVSKQSLKE
FT                   SLKKLRSLEKKINELNKYEDNLEEIKADIERLGKLNSAEEIIRYVEKIKGKIDSLEKDV
FT                   EQDLNKIIDDKIKNIEEINDRLKLYAKILYHFLKIQKDVKTFSIPKEKSLSKLNEVEIQ
FT                   AKQHLNELYEIIVNELGKLNLNENEINILIILIDKGEIKISKDNLEEAIKVMKMLVERN
FT                   ISIKVKV"
     atggatttgg atgagtttat agaaaaattg acccaatata agcagaattt ggacgtagaa        60
     aagcttagag aagaagatag aaaaattact gagatgatag aggaattaga ggtatctaaa       120
     caaagtctga aggagtctct aaagaaatta aggagcttag agaagaagat aaacgaatta       180
     aataaatatg aagataatct tgaggaaatt aaagcagata tagagaggct aggcaagctc       240
     aattccgcag aagaaataat tagatacgta gagaagataa aaggaaaaat tgacagctta       300
     gaaaaggatg tagaacaaga tctgaataag ataatagacg ataagattaa gaacatcgag       360
     gaaataaatg atagactaaa attgtatgcg aaaattttgt atcattttct taaaattcag       420
     aaagatgtaa aaacttttag tatacctaag gagaaatcac tttctaagct aaatgaagtc       480
     gaaatacaag ctaaacaaca ccttaatgaa ctatacgaga ttatcgttaa cgagttagga       540
     aaattaaatc taaacgagaa tgagattaac atactgataa tactaataga caaaggcgaa       600
     ataaagatta gtaaagataa tttagaagag gctattaagg ttatgaaaat gcttgtagag       660
     agaaatattt cgataaaggt gaaagtttga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page