(data stored in ACNUC7421 zone)

EMBL: CP001402.PE153

CP001402.PE153       Location/Qualifiers
FT   CDS_pept        131661..131987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40789"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK48"
FT                   /protein_id="ACR40789.1"
FT                   /translation="MLSLSELNGKLYDPDDKDQQYCLRKAKCYIDRTVDPPVIRVIKSD
FT                   DDYEIIGWVWLTERGELKMNGVNVTPGDRYFIYNNKKFPPGVYYLIRKNGHEILVSEKT
FT                   LKSL"
     atgttatcgc taagtgaact taacggaaag ctatatgacc cagacgacaa agaccaacaa        60
     tattgcttac gcaaagcaaa atgttacata gaccgcactg tagacccgcc cgtaatacgc       120
     gtgattaaga gcgacgatga ctacgagatt atcggttggg tgtggctaac ggaacgcggt       180
     gaattgaaaa tgaatggcgt taatgttacg ccgggcgata gatatttcat atataataat       240
     aagaaattcc cgccgggcgt ttattatctg atacgcaaaa acgggcatga gatattggtg       300
     agcgaaaaga cgcttaagtc actttga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page