(data stored in ACNUC7421 zone)

EMBL: CP001402.PE154

CP001402.PE154       Location/Qualifiers
FT   CDS_pept        132859..133848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0156"
FT                   /product="transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40790"
FT                   /db_xref="GOA:C4KK49"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK49"
FT                   /protein_id="ACR40790.1"
FT                   /translation="MQGNKVKSFTLPIISYAVPTFVLVYPSFFVGWLSDSMHLAYWEVF
FT                   AIVALPFLGRIIGSFIYQLFKGSVVSYCFPLLGFLVVLQNFLGALVFVRFLVGVIFGLL
FT                   TSYAVESAVRSGRNVLVGFTTAGWSMGWVISYLAYSLLKNWNVITISGILIMFLALFEL
FT                   NKEEFRERGMSSVSFPRLTSILIYISALTPAFILQVMPSFLETIKLTWLILPSYLLSIP
FT                   TYVLLPMISGKVGIRKVLVISSIIVILSSIITFLLLPMMVIVFTSIGLGILGITPKYLA
FT                   IRGEDPKRMGLALNIGSVMGLIVPVLYALMPFSPEFLLSILMVLMLLI"
     ttgcaaggta ataaagtgaa atcctttacg ttaccgatta tttcatatgc tgttcctaca        60
     tttgtgttgg tgtatccatc gttctttgta ggctggctca gtgattctat gcatttagcg       120
     tattgggagg tgttcgcaat agttgcttta ccatttctag gtaggataat tggttctttc       180
     atatatcagt tattcaaagg tagtgtagtt tcttactgtt ttccgttgct tggtttttta       240
     gttgttcttc aaaacttttt aggggcttta gtttttgtga gatttctagt aggggtaata       300
     tttggtctgt taacgagcta tgcggttgag agtgctgtaa gaagtggtag aaatgtatta       360
     gtaggtttta ctaccgcagg ttggtctatg ggttgggtaa ttagctatct tgcgtattcc       420
     ttacttaaaa attggaatgt aattacaata agtgggattt taataatgtt tttagcgttg       480
     tttgagttaa acaaggaaga gtttagagag aggggtatga gttctgtatc ttttcccagg       540
     cttacctcaa tactgattta tatatcggcg ttaacaccgg ctttcatttt gcaagttatg       600
     ccgagttttt tggagacgat aaagcttact tggcttattc ttccatccta tttgttatca       660
     attccaactt acgtgctttt acctatgatt agtggaaaag tgggaattag aaaggttttg       720
     gttattagtt ccattattgt aattcttagt agtattatta cttttcttct attgcccatg       780
     atggtaattg tttttactag tattggtctt ggtattttag ggataacgcc taagtatctt       840
     gcaattagag gtgaagatcc aaagaggatg ggtttggctt tgaatattgg ttcagtgatg       900
     ggtctcatag taccagtact gtatgcgcta atgccatttt caccagagtt tttattatca       960
     attttaatgg ttttgatgtt attgatatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page