(data stored in ACNUC7421 zone)

EMBL: CP001402.PE155

CP001402.PE155       Location/Qualifiers
FT   CDS_pept        133940..135013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0157"
FT                   /product="eRF1 domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40791"
FT                   /db_xref="GOA:C4KK50"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK50"
FT                   /protein_id="ACR40791.1"
FT                   /translation="MKALIKELKKWKAPATVLLSLYIPPGRPIPDVVNLLRQEYSIAQN
FT                   IKLKRTRDAVLSAIGAAIDRLNKIPKIDGNGLVLFCGENFDTEDFKCFMFSPPDKVPLF
FT                   FYRTDKEFHVEFLEDMVEDTVVYGLIIVERDEATIGLLKGTRIEILEEIEGFVPGKHMM
FT                   GGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMPFIQTGKMKGILLGGPGYAKEDFYKED
FT                   YVDYRIKNLILQPLIDVSDQGEVGLREMIMRAEDLLKNQQYVEVEKLLEELKYHLAKDD
FT                   GLIIYGKEQIKKAMEMGAVEAIVIHEDSSDKELEKLAQDAENYGVKVFVVGDEVPEAEW
FT                   VKKTFNGVVGKLRYRLY"
     ttgaaggcac taattaagga attgaagaaa tggaaagctc cagctactgt tcttctgtct        60
     ttatatatac cacccggtag accaattcca gatgtggtta atctacttag gcaagagtac       120
     tccatagctc agaatataaa gctcaagagg actagagatg cagtactttc cgcgataggt       180
     gcggcaatag ataggctgaa caagataccg aagatagatg gtaatggttt agtattgttt       240
     tgtggtgaaa atttcgatac tgaggatttc aaatgtttta tgttttctcc tcctgataaa       300
     gttccattat tcttctatag aactgacaag gagtttcatg tggaattttt ggaggatatg       360
     gtggaggata ctgtagtata tggtcttata attgtggaga gggatgaggc cactataggt       420
     ttacttaagg gaactagaat agaaatttta gaggaaattg aaggttttgt gccagggaag       480
     catatgatgg gaggacagtc ccagaggaga attgacagaa taatagacga aatgtatcat       540
     aatttcttaa aagaggttgg tgagaaagtc aatgcgtatt ttatgccttt tattcagacg       600
     ggcaagatga aaggtatatt attaggtggt ccaggatatg ctaaggagga tttctataag       660
     gaagattatg ttgactatag gataaagaat ttaattttac aacccttaat tgacgtttct       720
     gatcaaggtg aggttggatt aagggaaatg ataatgaggg ctgaggattt attaaagaat       780
     caacaatacg ttgaggtgga gaaattacta gaggaattaa aataccattt ggctaaggat       840
     gatggattaa taatatatgg aaaggagcaa attaaaaaag ctatggaaat gggagcagta       900
     gaggctatag taattcatga ggactctagt gataaagagt tagagaaatt agctcaagat       960
     gcggaaaatt atggcgttaa ggtttttgtg gttggtgatg aagtaccaga ggctgaatgg      1020
     gttaaaaaaa cgtttaatgg cgtagtgggt aagttaaggt ataggctata ttaa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page