(data stored in ACNUC7421 zone)

EMBL: CP001402.PE158

CP001402.PE158       Location/Qualifiers
FT   CDS_pept        136503..137291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40794"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK53"
FT                   /protein_id="ACR40794.1"
FT                   /translation="MFLLQQSEDSTSIRKLVKFLNINFPQIDLIVYGRGLELPSFTLAR
FT                   ALSSLKNKIISTLNIYDFLFIYNPYVEVSNVVAFTGDENELRELLDGLESLRVRGSIYH
FT                   CGVTDIKPRYNLISINSLDKTFCEINLSLSILKVLSNNKNTEREKRILDQLNDLSDLDD
FT                   YVKNYAKVFNPDLPILLSPVMLPAKSFLESLGINVSSYFDTKILDGAQIVYTGVDMYIT
FT                   RRMIFSLKSKGKKVTDVLIDVDPLLAPIYLSMIMFYLKKK"
     gtgttcctgt tgcaacagtc tgaagacagc actagtataa gaaaattggt gaagttttta        60
     aacattaatt ttccgcaaat agatttaata gtatatggtc gtggtcttga actcccttca       120
     tttactcttg caagagctct ttcttccttg aagaataaaa taatcagcac attaaatatt       180
     tatgattttc tgtttattta caatccctat gttgaagttt caaacgttgt agcgtttact       240
     ggggacgaaa atgaattgcg ggaactttta gatggtctag agagtttaag agtaagagga       300
     agcatttacc attgtggtgt tacagatatt aaacctagat ataatcttat ttcaattaat       360
     agtttggata aaactttctg tgagattaat ctatccctat ccattttaaa ggtactaagt       420
     aataataaaa atacagagag agaaaaaaga attttagatc aattaaacga cctttcggat       480
     ttagatgatt acgtgaagaa ttatgccaaa gttttcaacc cggatttgcc tattctctta       540
     tctccggtca tgcttccagc taagtccttc ttagagagtc ttgggataaa tgtttcaagt       600
     tattttgata ctaaaatatt agatggtgca caaatagttt atactggtgt cgatatgtat       660
     attactagaa ggatgatttt ttccttaaaa tcaaagggga aaaaggttac tgatgttctg       720
     atagatgtag acccactatt agcacccata tatttaagta tgattatgtt ttacttaaaa       780
     aagaaataa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page