(data stored in ACNUC7421 zone)

EMBL: CP001402.PE16

CP001402.PE16        Location/Qualifiers
FT   CDS_pept        complement(11678..14716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40652"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD2"
FT                   /protein_id="ACR40652.1"
FT                   /translation="MSCYKRISETASDSSYIYQIFSCISENPLYINRLRFFKQVKDEID
FT                   RISKTKQSPEIISLVADWGQGKSTFLDIIDEYAKSKNISVIKVPFVELLSKTEDLLTFR
FT                   NNIYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIVYLSMTPSAYSKIFGTGG
FT                   LIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLKMANVKDFKILQYMDLPYWVI
FT                   DQERRKYVRFFNDVLCDNLPNIDRIFNELARSEKGISLNSEGETIKLDTLTKMENELDS
FT                   QESSNLYRVLMSRIFTDEKLIIKQLEGHVVKGVLLPYLKWIEIFPKGQEYVEDFLLTYY
FT                   QDDFHVFLSDNIESVVYESIDTSKLKENIKKLTLFSKTEAYALSWNFFESVANTNIGGL
FT                   VVEFKSREIRDKALQFVNTYITDREKELESLEYFMEVLGIKIDSANRTRDYIRFLKIVD
FT                   RNDKITIILAKPSNEDEIKSLIKEIKESDDIIHGIILIEPQIGKEELSKTLDELSIPLI
FT                   ELKITTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIRDNLNLKQLP
FT                   IPKNKRLIQSFNWIIFYPSIKMANADEVFDKVNDIINEKFRMYGSKQFHLEDIETSNTF
FT                   IEDVITYFYNNYIIKIRANYIDFEDLAGDSLSSFSKLFAGLIRQKYKQEAEDVVFNYIM
FT                   YYVNPQDTRRKDNKNNPLAFAYQIFNPDKKIGQNPTLDFLVYSSIVSGEVAKYLNKDSI
FT                   YMKINDQIRKIKEKLDNPYSAYGYFITAKKRGAAVRSLEEMREVIETYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRETEKSVIETDKIVEEISKKLEVVEKAKRYVKINEKIEEIEKV
FT                   REIVRELKDNFKIHMDKLAKRIQEINERGETESFKRYLDYLLTTIHVEDNSNLYFILFK
FT                   LLKETLNGIAIVGEELKGTIVDEITSLSKVGIQLNNIETIVNELEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEHGFG"
     gtgagttgtt acaagagaat aagtgagact gcctctgact cgtcttacat ctatcaaatt        60
     ttctcttgca ttagcgagaa cccattatac attaatagac tgagattttt caagcaggtt       120
     aaggatgaga tagacaggat atctaagact aaacagtccc cagaaataat atcccttgta       180
     gccgattggg gtcaaggaaa aagcacattc cttgacatta ttgatgaata cgccaaaagc       240
     aaaaatatta gcgtaataaa agtacctttt gtagaacttt taagtaaaac tgaggacttg       300
     ttaacgttca gaaataacat atatcttatt gatgaggtag agagttctgt agattacttt       360
     gcagaatatc aaaacgagat aaaggatttt tggagtaagg taaaggaatt agcaaactca       420
     accggaaatt caatagtata tctttccatg actcctagtg catattctaa aatatttgga       480
     actggaggat taatttataa cctattttca gagacatacc cttcactctt agaaagaata       540
     aggaaagtta gtatagaaaa tccatctaaa ttagagtttc tattgatgtt aaaatgcatg       600
     ctaaagatgg ctaacgtaaa ggacttcaaa atactccaat acatggattt gccgtactgg       660
     gtaatagacc aagaaagaag aaaatacgta aggttcttca acgatgtatt gtgcgacaat       720
     cttcctaata tagatagaat tttcaacgaa ctagccagat cagagaaagg aattagccta       780
     aattcagaag gggagaccat caagctagat acattgacga aaatggagaa cgaattggac       840
     tctcaagaat caagtaattt atatagagtg ctaatgagta gaatattcac tgacgaaaaa       900
     ctaatcataa aacaattaga aggtcatgta gtgaagggag tactactacc atacctaaaa       960
     tggattgaga tattccctaa aggacaagaa tacgtagagg acttcctttt aacatactat      1020
     caagatgact ttcacgtatt tctatctgat aatatagaaa gtgtagtgta cgaaagtata      1080
     gatacaagca aattaaaaga gaatattaaa aaactaacgc tattcagtaa aactgaagcc      1140
     tatgcattat cttggaactt ctttgagagc gtagcgaata cgaatatagg aggactagta      1200
     gtagagttca agtctaggga aatacgagat aaagctctac agttcgtaaa tacatatatt      1260
     acagatagag agaaggaact tgaatcacta gaatatttta tggaggttct aggaataaaa      1320
     atagatagtg ctaacagaac cagagactac ataaggtttt taaaaattgt cgatagaaat      1380
     gacaaaatta caattatttt agcaaaacca tctaacgagg atgaaattaa gagtctaata      1440
     aaagagatta aagaaagcga tgatataatt cacggaatta ttctaataga gcctcaaata      1500
     ggaaaggaag aattgtctaa aactttagac gaactatcaa tacctttgat cgaactaaaa      1560
     atcaccacac caaagaaaag acagttatta tatctactat tctctaagat ctatgggcaa      1620
     agtagaatta gactggattc catagaacta agactaggtg acttgaaaaa ttcgatatcc      1680
     tctctactgc taaaaataag agataacctt aatttgaaac aacttccaat acctaaaaat      1740
     aagagattaa tacaatcgtt caattggata atattttacc cttcaattaa gatggcaaac      1800
     gctgatgaag tgttcgacaa agtaaatgac atcattaatg agaaattcag aatgtatgga      1860
     agtaagcaat tccatttaga ggatatagaa acatcaaaca catttattga agacgttatt      1920
     acttacttct ataataatta tataataaag ataagagcta attacataga tttcgaagac      1980
     ttagctggag actcgttatc ctcattttct aagctatttg cgggacttat tagacaaaaa      2040
     tacaaacaag aagcggagga tgttgtattt aattatataa tgtactatgt aaacccacaa      2100
     gatacaagaa gaaaggataa taaaaataat cctttagcct tcgcttacca aatttttaat      2160
     cctgataaaa aaattggaca aaatcccact ttagatttcc tagtttactc ttcaatagtt      2220
     agtggtgaag tcgccaaata tttaaataaa gattcaattt atatgaaaat aaatgaccag      2280
     atacgaaaaa taaaggaaaa actagataat ccatactcag cttatggata cttcataact      2340
     gctaaaaaga ggggagctgc agtaaggagt cttgaagaaa tgagagaagt catagaaaca      2400
     tatgagaaat cttgcactga aaataaggat ataaggctat gttatgatta tctctaccta      2460
     tcgaatattt atctggaatt attaagagag accgagaaat cagtaattga aacggacaag      2520
     atcgtggagg aaatctctaa gaaattagaa gttgtggaaa aggctaagag atatgttaag      2580
     ataaacgaga aaatagagga aatagagaaa gtacgtgaga tagttcgaga acttaaagac      2640
     aatttcaaaa tacacatgga taagttggcg aaaagaattc aggagataaa tgaaagggga      2700
     gaaacggagt ctttcaaaag atacctcgat tacttactta ctacaattca tgttgaagac      2760
     aactcgaatc tttatttcat attattcaaa ttactgaaag agacactaaa tggcatagca      2820
     atcgttggtg aagagttaaa aggaacaata gtagatgaaa ttacatcatt aagtaaggtc      2880
     ggtattcaat taaataatat tgagacgatt gtaaatgagt tagaaaagat aagtccagaa      2940
     ttacctaagt tgagggagaa cgtggagaga aacacgcaaa agataacgca attgattcaa      3000
     gaaataaagg aggttctaga agaacatgga tttggatga                             3039
//

If you have problems or comments...

PBIL Back to PBIL home page