(data stored in ACNUC7421 zone)

EMBL: CP001402.PE163

CP001402.PE163       Location/Qualifiers
FT   CDS_pept        complement(140587..141099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40799"
FT                   /db_xref="GOA:C4KK58"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK58"
FT                   /protein_id="ACR40799.1"
FT                   /translation="MKASYTLPLSILMIVLPIVPGLVDSFIAFLVGALIDFIVAVYVLI
FT                   SEKPWANDIKTAISTLYFTALSTFADVAGVFFVMAYQDEYKFAIVTLTLSIPFIYNLFL
FT                   VLKSVLPNIIKRDMLYVGNGFFAFILVLIIGAIIGRAFITNFYALLPLYTGFLILAIIA
FT                   LFYFRKK"
     atgaaagcca gttatacgtt acccctttcc atattgatga tagttttacc aatagttcca        60
     ggattagtag actcttttat agcatttttg gtaggagctc taatagactt tattgttgca       120
     gtatatgttt taatttctga aaaaccttgg gcaaatgata taaaaactgc aattagcact       180
     ctttacttta ctgcgttgtc aacatttgca gatgtagcgg gggttttctt tgttatggca       240
     tatcaagatg agtacaaatt cgccatagtt acgttaacct tatctattcc attcatatat       300
     aacttgtttc tagtgttgaa atcagtatta cctaatataa taaagagaga tatgttatat       360
     gtaggaaatg gattctttgc atttatatta gttttaatta ttggagcaat aataggcaga       420
     gcgtttataa caaactttta cgcgctctta ccattatata ctggattttt aatactagct       480
     attatagctt tattttactt cagaaaaaag tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page